Entry information : CfioAPx-CcP04_MH18
Entry ID 11822
Creation 2013-04-29 (Christophe Dunand)
Last sequence changes 2013-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-04-20 (Christophe Dunand)
Peroxidase information: CfioAPx-CcP04_MH18
Name CfioAPx-CcP04_MH18
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum fioriniae (Glomerella acutata)    [TaxId: 710243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfioAPx-CcP04_MH18
start..stop
S start..stop
CfioAPx-CcP04_PJ7 2196 0 1..1097 1..1097
CgraAPx-CcP 1571 0 1..1097 1..1062
CgraAPx-CcP01 1128 0 15..735 15..747
CgraAPx-CcP01 174 3.68e-45 783..1062 463..747
CgraAPx-CcP01 143 3.26e-35 655..768 553..666
CgraAPx-CcP01 107 6.99e-24 1002..1095 575..666
CgloAPx-CcP02_Naragc5 1026 0 1..772 1..774
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11822' 'complement(join(328366..329474,329525..331709))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 329525..331709 2183 N° 2 328366..329474 1107  
complement(join(328366..329474,329525..331709))


exon

Literature and cross-references CfioAPx-CcP04_MH18
DNA ref. JGI genome:   scaffold_16 (331709..328366)
Cluster/Prediction ref. JGI gene:   1462000
Protein sequence: CfioAPx-CcP04_MH18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   1097 (1077)
PWM (Da):   %s   113553.1 (111385.8)  
PI (pH):   %s   4.95 (4.80) Peptide Signal:   %s   cut: 21 range:21-1097
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVKSSILLSLLGLASQAQADPTWPSDIDELEEIMYQSFNFGSRHFADNVFPCAKEATGTGRQTAAEWLRTAFHDMAPANAGTGVGGLDASIQYELSSTGENTGPAFSSTLTFMGHYLTR
KSSMSDLIALGVYTSVLSCGGPSVAIRSGRIDATVKGAAGVPQPNEVIQVFNSKFNRMGFTPQEMIQVTACGHTIGGVHTAENPTIVPDGTNTNGSAPMDSSNGVFDNRVVTEYLDGTTR
NPLVIKMGTARASNSDFVVFSSDKNATVKAMTDLAVFKSTCKTVFEKMINTVPSGVTLGDAIAPYTVKPSQLQLSLTSSTIMTLTGYIRVRTTAITGISSLTINYKNRSGGSTCGTGSCV
FTITISGISKGLEDSFSWYPIRQEIPVSTGISSFTVTINKSDGSSTLFNNNGNWYPIQDGIFLQTSQSCLTQNSGDVTLVAAVRNDRTSLPVKAEISYKTARTSSVVPLLGKMTVDMVKG
DCVGSYTFYSVTTNIPGGVSFESTFDFISGEGASAMIDPFKKADPIGGTCSSWTGGSPTCGSVTVSSSTSSAAATATISHRQTMGGYKLVSCWTEASGGRALSGAAFAYDGMTLDSCMAN
CTGFDYWGTEYGRECYCGNSLAASSSSAPLADCSMQCSGDSTQYCGAGNRIELYSTTATRTSSSTAAPTATLAHINTVGKYSLVGCQTEADGGRALSAAQTAADDMTLDKCASFCSDYTF
FGTEYGRECYCGNSLAATSKTAPLSECNMKCAGNSYQYCGDGNRLELYKVGSASSTLASTVATTTSSSSSSTSSISVSAASGSSSSTLISASSTSSTSSTSSPVSTSSSSSVASSSSSTS
SNSVASSTSVTSSSSTSSSIVSSSSSAVTSSTASPSASSTVSTSTTTSPTLAHRPTISPYTLVGCWTEGNGVRALSQKNYASGDNMTLEYCASYCSDYKYFGTEYSSECYCGNTLASTSA
AAPLADCSMTCSGNKYEYCGGGNRLTLYQSDKQVTGPSQPATAGAYAFLGCRTEPAQGGRALDGKATASSDKMTNEACAAFCDGYSYFGTEYGGECYCGNSLPTTSLDAPLSDCSMLCTG
SSTEYCGNGNRLSVYKK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Peroxidase domain fused to 4 WSC domains (putative carbohydrate binding domain).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGTGAAATCATCAATACTGTTGAGCCTGCTCGGCTTAGCCTCACAGGCCCAGGCTGATCCGACATGGCCCTCGGACATTGACGAGTTGGAGGAGATCATGTACCAGTCGTTCAAT
TTCGGATCGCGACACTTTGCCGACAACGTCTTCCCCTGCGCCAAGGAGGCAACGGGCACCGGCCGCCAAACTGCTGCAGAATGGCTGCGAACCGCTTTTCACGATATGGCACCGGCCAAC
GCAGGGACAGGAGTTGGTGGGTTGGATGCATCTATACAATATGAGCTGTCGAGCACCGGCGAGAATACCGGCCCTGCCTTTTCGTCAACTCTGACCTTTATGGGACATTACTTGACCCGC
AAAAGCAGCATGTCGGATCTCATCGCTCTTGGAGTCTATACTTCGGTCCTGTCGTGCGGCGGTCCCTCAGTTGCAATCCGATCCGGCCGCATCGACGCAACCGTGAAAGGAGCCGCAGGC
GTACCGCAGCCCAACGAAGTCATCCAAGTTTTCAACTCGAAGTTTAATCGCATGGGATTCACTCCACAAGAGATGATTCAAGTCACAGCTTGCGGCCATACAATTGGCGGCGTCCACACG
GCCGAGAATCCAACCATCGTTCCAGACGGCACAAATACCAACGGCTCCGCGCCCATGGATAGCTCAAACGGTGTCTTTGACAACAGAGTTGTGACCGAATATCTAGATGGCACCACGCGG
AACCCGCTTGTCATCAAAATGGGCACTGCTCGAGCCAGTAATTCCGATTTCGTCGTTTTCAGCTCCGACAAGAACGCCACCGTGAAGGCCATGACCGACCTCGCAGTCTTCAAGTCTACC
TGCAAGACCGTCTTCGAGAAGATGATCAACACCGTGCCATCTGGTGTTACTCTCGGCGATGCCATCGCACCCTACACCGTCAAGCCGTCCCAGCTTCAGCTCTCCCTCACTTCGTCCACC
ATCATGACTCTTACAGGCTACATTCGCGTCCGAACTACCGCCATCACAGGCATCTCGAGTCTGACGATCAACTATAAGAACCGGAGTGGCGGGTCTACCTGCGGTACTGGCTCCTGTGTC
TTTACAATCACCATCTCGGGTATTTCTAAGGGCTTGGAAGACAGCTTCTCCTGGTATCCCATCAGGCAGGAGATTCCGGTCAGCACGGGCATCTCGTCCTTTACTGTGACGATCAACAAG
AGCGATGGCTCGAGCACATTATTTAACAACAATGGCAACTGGTACCCGATTCAGGACGGTATCTTTCTCCAGACGTCCCAGAGCTGCTTAACGCAGAACTCTGGCGATGTTACACTTGTC
GCCGCAGTCCGCAACGACCGCACGTCTCTCCCGGTCAAGGCAGAAATCTCTTACAAGACAGCGCGAACAAGCAGCGTGGTGCCCCTGCTAGGTAAGATGACCGTCGACATGGTCAAGGGT
GATTGTGTTGGCAGCTACACCTTTTACAGTGTCACCACGAACATTCCTGGTGGCGTCAGTTTCGAGTCGACTTTTGACTTCATCAGCGGAGAGGGCGCGTCCGCCATGATTGACCCGTTC
AAGAAGGCCGACCCTATCGGTGGGACATGTTCGAGCTGGACGGGAGGGTCTCCGACATGTGGCAGCGTCACAGTGTCGTCTTCTACGTCCAGCGCGGCTGCGACTGCTACGATTTCACAC
AGACAGACCATGGGCGGCTACAAGCTCGTCTCCTGCTGGACCGAGGCTTCTGGTGGCCGAGCTCTCAGCGGTGCCGCGTTCGCTTACGACGGCATGACCCTCGACAGCTGCATGGCAAAC
TGCACGGGGTTCGACTACTGGGGTACCGAATACGGACGCGAATGCTACTGCGGCAACTCTTTGGCTGCGTCTAGCAGTTCCGCACCGTTGGCCGATTGCAGCATGCAGTGCTCTGGTGAT
TCTACCCAGTACTGCGGAGCCGGCAATCGCATTGAGCTCTACTCGACCACCGCCACCCGCACCAGCAGCTCCACGGCCGCTCCTACGGCTACTCTCGCACACATCAACACCGTCGGCAAG
TACTCACTCGTCGGCTGCCAGACGGAGGCCGATGGTGGTCGCGCACTTTCTGCTGCCCAGACTGCTGCGGACGACATGACTCTCGACAAGTGTGCTTCTTTCTGCTCCGACTATACATTC
TTCGGCACTGAGTATGGACGCGAAT
GTAAGTGTTGATTATATCTTGAGGTATGGATGAGAACTAACACAAAGTAGGCGCTATTGCGGTAACAGCCTGGCAGCAACCAGCAAGACTGCGCC
CCTGAGCGAGTGTAACATGAAGTGTGCTGGTAACTCGTACCAGTACTGCGGTGACGGCAACCGCCTGGAGCTGTACAAAGTCGGCAGTGCCTCGTCTACTTTGGCTTCGACGGTGGCTAC
TACGACCTCGAGCAGTTCTTCATCCACGAGCTCTATCAGTGTCTCAGCGGCGAGCGGATCATCGTCTTCTACTCTGATATCTGCATCCTCTACTTCCAGCACCTCTTCGACCTCGTCGCC
GGTGTCTACTTCAAGTTCGAGCAGTGTCGCATCTTCCAGCAGCTCTACTTCTTCTAACAGCGTAGCATCCTCAACCAGTGTCACGTCCTCCTCAAGCACCTCATCGAGCATTGTCTCATC
CTCCAGCAGCGCCGTCACTTCATCGACAGCCTCGCCTTCGGCCTCAAGCACCGTCTCAACCTCAACAACCACATCTCCGACGCTAGCTCACAGGCCTACCATCTCGCCCTACACTCTGGT
AGGCTGCTGGACGGAAGGCAACGGTGTCCGCGCCCTGAGTCAGAAGAACTACGCCTCTGGCGACAACATGACGCTCGAGTACTGCGCCTCGTACTGCTCAGACTACAAGTACTTTGGCAC
TGAATACAGCAGCGAATGCTACTGCGGCAACACCCTCGCCTCCACGAGCGCCGCCGCCCCCCTGGCAGACTGCAGCATGACCTGCAGCGGCAACAAGTACGAGTACTGCGGCGGCGGCAA
CCGCCTGACCCTCTACCAGTCCGACAAGCAGGTAACGGGCCCCAGCCAGCCCGCCACAGCCGGAGCCTATGCTTTCCTCGGCTGCCGCACCGAACCCGCGCAGGGCGGACGCGCTCTGGA
TGGGAAGGCTACGGCCAGCAGCGATAAGATGACCAACGAGGCGTGCGCGGCATTCTGCGATGGGTATAGCTACTTCGGAACGGAGTACGGCGGCGAGTGCTACTGTGGTAATTCCCTGCC
GACGACGTCGCTTGATGCCCCGTTGAGCGATTGCAGTATGCTGTGTACGGGTTCCAGCACAGAATACTGCGGTAACGGCAATCGTTTGTCAGTGTATAAAAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGTGAAATCATCAATACTGTTGAGCCTGCTCGGCTTAGCCTCACAGGCCCAGGCTGATCCGACATGGCCCTCGGACATTGACGAGTTGGAGGAGATCATGTACCAGTCGTTCAAT
TTCGGATCGCGACACTTTGCCGACAACGTCTTCCCCTGCGCCAAGGAGGCAACGGGCACCGGCCGCCAAACTGCTGCAGAATGGCTGCGAACCGCTTTTCACGATATGGCACCGGCCAAC
GCAGGGACAGGAGTTGGTGGGTTGGATGCATCTATACAATATGAGCTGTCGAGCACCGGCGAGAATACCGGCCCTGCCTTTTCGTCAACTCTGACCTTTATGGGACATTACTTGACCCGC
AAAAGCAGCATGTCGGATCTCATCGCTCTTGGAGTCTATACTTCGGTCCTGTCGTGCGGCGGTCCCTCAGTTGCAATCCGATCCGGCCGCATCGACGCAACCGTGAAAGGAGCCGCAGGC
GTACCGCAGCCCAACGAAGTCATCCAAGTTTTCAACTCGAAGTTTAATCGCATGGGATTCACTCCACAAGAGATGATTCAAGTCACAGCTTGCGGCCATACAATTGGCGGCGTCCACACG
GCCGAGAATCCAACCATCGTTCCAGACGGCACAAATACCAACGGCTCCGCGCCCATGGATAGCTCAAACGGTGTCTTTGACAACAGAGTTGTGACCGAATATCTAGATGGCACCACGCGG
AACCCGCTTGTCATCAAAATGGGCACTGCTCGAGCCAGTAATTCCGATTTCGTCGTTTTCAGCTCCGACAAGAACGCCACCGTGAAGGCCATGACCGACCTCGCAGTCTTCAAGTCTACC
TGCAAGACCGTCTTCGAGAAGATGATCAACACCGTGCCATCTGGTGTTACTCTCGGCGATGCCATCGCACCCTACACCGTCAAGCCGTCCCAGCTTCAGCTCTCCCTCACTTCGTCCACC
ATCATGACTCTTACAGGCTACATTCGCGTCCGAACTACCGCCATCACAGGCATCTCGAGTCTGACGATCAACTATAAGAACCGGAGTGGCGGGTCTACCTGCGGTACTGGCTCCTGTGTC
TTTACAATCACCATCTCGGGTATTTCTAAGGGCTTGGAAGACAGCTTCTCCTGGTATCCCATCAGGCAGGAGATTCCGGTCAGCACGGGCATCTCGTCCTTTACTGTGACGATCAACAAG
AGCGATGGCTCGAGCACATTATTTAACAACAATGGCAACTGGTACCCGATTCAGGACGGTATCTTTCTCCAGACGTCCCAGAGCTGCTTAACGCAGAACTCTGGCGATGTTACACTTGTC
GCCGCAGTCCGCAACGACCGCACGTCTCTCCCGGTCAAGGCAGAAATCTCTTACAAGACAGCGCGAACAAGCAGCGTGGTGCCCCTGCTAGGTAAGATGACCGTCGACATGGTCAAGGGT
GATTGTGTTGGCAGCTACACCTTTTACAGTGTCACCACGAACATTCCTGGTGGCGTCAGTTTCGAGTCGACTTTTGACTTCATCAGCGGAGAGGGCGCGTCCGCCATGATTGACCCGTTC
AAGAAGGCCGACCCTATCGGTGGGACATGTTCGAGCTGGACGGGAGGGTCTCCGACATGTGGCAGCGTCACAGTGTCGTCTTCTACGTCCAGCGCGGCTGCGACTGCTACGATTTCACAC
AGACAGACCATGGGCGGCTACAAGCTCGTCTCCTGCTGGACCGAGGCTTCTGGTGGCCGAGCTCTCAGCGGTGCCGCGTTCGCTTACGACGGCATGACCCTCGACAGCTGCATGGCAAAC
TGCACGGGGTTCGACTACTGGGGTACCGAATACGGACGCGAATGCTACTGCGGCAACTCTTTGGCTGCGTCTAGCAGTTCCGCACCGTTGGCCGATTGCAGCATGCAGTGCTCTGGTGAT
TCTACCCAGTACTGCGGAGCCGGCAATCGCATTGAGCTCTACTCGACCACCGCCACCCGCACCAGCAGCTCCACGGCCGCTCCTACGGCTACTCTCGCACACATCAACACCGTCGGCAAG
TACTCACTCGTCGGCTGCCAGACGGAGGCCGATGGTGGTCGCGCACTTTCTGCTGCCCAGACTGCTGCGGACGACATGACTCTCGACAAGTGTGCTTCTTTCTGCTCCGACTATACATTC
TTCGGCACTGAGTATGGACGCGAAT
GCTATTGCGGTAACAGCCTGGCAGCAACCAGCAAGACTGCGCCCCTGAGCGAGTGTAACATGAAGTGTGCTGGTAACTCGTACCAGTACTGCGGT
GACGGCAACCGCCTGGAGCTGTACAAAGTCGGCAGTGCCTCGTCTACTTTGGCTTCGACGGTGGCTACTACGACCTCGAGCAGTTCTTCATCCACGAGCTCTATCAGTGTCTCAGCGGCG
AGCGGATCATCGTCTTCTACTCTGATATCTGCATCCTCTACTTCCAGCACCTCTTCGACCTCGTCGCCGGTGTCTACTTCAAGTTCGAGCAGTGTCGCATCTTCCAGCAGCTCTACTTCT
TCTAACAGCGTAGCATCCTCAACCAGTGTCACGTCCTCCTCAAGCACCTCATCGAGCATTGTCTCATCCTCCAGCAGCGCCGTCACTTCATCGACAGCCTCGCCTTCGGCCTCAAGCACC
GTCTCAACCTCAACAACCACATCTCCGACGCTAGCTCACAGGCCTACCATCTCGCCCTACACTCTGGTAGGCTGCTGGACGGAAGGCAACGGTGTCCGCGCCCTGAGTCAGAAGAACTAC
GCCTCTGGCGACAACATGACGCTCGAGTACTGCGCCTCGTACTGCTCAGACTACAAGTACTTTGGCACTGAATACAGCAGCGAATGCTACTGCGGCAACACCCTCGCCTCCACGAGCGCC
GCCGCCCCCCTGGCAGACTGCAGCATGACCTGCAGCGGCAACAAGTACGAGTACTGCGGCGGCGGCAACCGCCTGACCCTCTACCAGTCCGACAAGCAGGTAACGGGCCCCAGCCAGCCC
GCCACAGCCGGAGCCTATGCTTTCCTCGGCTGCCGCACCGAACCCGCGCAGGGCGGACGCGCTCTGGATGGGAAGGCTACGGCCAGCAGCGATAAGATGACCAACGAGGCGTGCGCGGCA
TTCTGCGATGGGTATAGCTACTTCGGAACGGAGTACGGCGGCGAGTGCTACTGTGGTAATTCCCTGCCGACGACGTCGCTTGATGCCCCGTTGAGCGATTGCAGTATGCTGTGTACGGGT
TCCAGCACAGAATACTGCGGTAACGGCAATCGTTTGTCAGTGTATAAAAAGTGA

Retrieve as FASTA