Entry information : CcorGPx04
Entry ID 11832
Creation 2013-05-06 (Gisèle Passaia )
Last sequence changes 2016-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-23 (Achraf Jemmat)
Peroxidase information: CcorGPx04
Name CcorGPx04
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Ancylistaceae Conidiobolus
Organism Conidiobolus coronatus    [TaxId: 34488 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcorGPx04
start..stop
S start..stop
SjapGPx01 133 1.61e-40 15..174 1..158
CcorGPx06 134 2.39e-40 3..175 22..195
BthGPx 132 2.83e-40 15..174 1..159
SYspGPx01 132 3.67e-40 18..174 9..169
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11832' 'join(201..468,519..576,627..729,784..879)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 201..468 266 N° 2 519..576 56 N° 3 627..729 101 N° 4 784..879 94
join(201..468,519..576,627..729,784..879)


exon

Literature and cross-references CcorGPx04
Cluster/Prediction ref. JGI gene:   171398
Protein sequence: CcorGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174
PWM (Da):   %s   20428.67  
PI (pH):   %s   7.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSIYLNYFHSENQLERIYNFSLTDIEGNNFKLDKLQNKVILIVNSACECGHASQLGDLQKMYNKFRRKGLEIVLLPSDEFNQELETNREINEFLKTEYKVEFPIMSKISLSGKEANPLI
TYLISELPHPKDAKNNKIKWNFEKFLINRSGKLVKRYASYEKLNEVVKDIEDLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTATCCATATATCTCAACTATTTCCACTCAGAAAATCAGCTAGAACGCATTTATAATTTCAGTTTAACTGATATAGAAGGAAATAACTTTAAACTAGATAAACTACAAAATAAAGTT
ATTTTGATAGTAAACTCAGCTTGTGAATGTGGTCATGCTAGTCAACTAGGGGACCTGCAAAAGATGTATAATAAATTTAGAAGAAAAGGTTTAGAAATTGTGCTACTTCCAAGTGACGAA
TTCAATCAAGAGCTGGAAACCAATAGAG
AGGTAATAAAGTACTGATTATATTATAGCTTGATTAACATATGAAATTTTAGAAATCAATGAATTTTTAAAAACTGAATATAAAGTAGAATT
TCCTATAATGTCAAAAAT
ATGTAAGAAAAATGCTATAATAGCTCTATAATATTAACAAGTGTATCTATAGCTCTCTATCTGGAAAAGAAGCAAATCCCTTAATCACATATTTAATAAGTG
AACTACCGCATCCAAAAGACGCTAAAAATAACAAAATTAAATGGAATTTTGAA
AAGTAAAAACACAAATAATCGTAAAAATTTATCTAATCTTTATTGATTTATAATAGAAATTTTTAAT
TAATCGCAGCGGAAAGCTAGTTAAAAGGTACGCATCTTACGAAAAGCTTAATGAAGTAGTTAAGGATATAGAAGATCTATTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTATCCATATATCTCAACTATTTCCACTCAGAAAATCAGCTAGAACGCATTTATAATTTCAGTTTAACTGATATAGAAGGAAATAACTTTAAACTAGATAAACTACAAAATAAAGTT
ATTTTGATAGTAAACTCAGCTTGTGAATGTGGTCATGCTAGTCAACTAGGGGACCTGCAAAAGATGTATAATAAATTTAGAAGAAAAGGTTTAGAAATTGTGCTACTTCCAAGTGACGAA
TTCAATCAAGAGCTGGAAACCAATAGAG
AAATCAATGAATTTTTAAAAACTGAATATAAAGTAGAATTTCCTATAATGTCAAAAATCTCTCTATCTGGAAAAGAAGCAAATCCCTTAATC
ACATATTTAATAAGTGAACTACCGCATCCAAAAGACGCTAAAAATAACAAAATTAAATGGAATTTTGAA
AAATTTTTAATTAATCGCAGCGGAAAGCTAGTTAAAAGGTACGCATCTTAC
GAAAAGCTTAATGAAGTAGTTAAGGATATAGAAGATCTATTATAA

Retrieve as FASTA