Entry information : ZcelCIIAC01
Entry ID 11842
Creation 2013-05-22 (Christophe Dunand)
Last sequence changes 2013-05-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-06-25 (Catherine Mathe (Scipio))
Peroxidase information: ZcelCIIAC01
Name ZcelCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Zasmidium
Organism Zasmidium cellare    [TaxId: 395010 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZcelCIIAC01
start..stop
S start..stop
CfulCIIAC02 343 4e-119 35..300 51..317
MfiCIIAC01 279 5e-94 35..298 42..307
ApulCIIAC02 259 2e-85 35..298 59..326
BcomCIIAC01 258 3e-85 35..299 63..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 273634..273736 103 N° 2 273801..274600 800  
join(273634..273736,273801..274600)


exon

Literature and cross-references ZcelCIIAC01
DNA ref. JGI genome:   scaffold_41 (273634..274600)
Cluster/Prediction ref. JGI gene:   28196
Protein sequence: ZcelCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   301 (279)
PWM (Da):   %s   31892 (29652.8)  
PI (pH):   %s   5.66 (4.94) Peptide Signal:   %s   cut: 22 range:22-300
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRCSSLLLAGLQLLALANSTYIAQPRDIAHDVVWKDIRSELWTRFQGCTRGASFAIRFAFHDAATTSLQTPYYAPASGGADGSLLLSDEESARSENNPLQAFRSNLSAIYDAYKPHIGAADLVQFAGSLGIYACSGGPLIKTVVGRKDSAAAAPPNLLPSAFGPGADADVLLSLFADKGFSPQDLSALVGAHTVSQSFAQQANHIPVGGQQDTTPTKWDVVFYQEAVAGKGARPRAFQFDSDVNLARGNETKGYFEQFAANKGSWDEAFVRAMEKMSLLGVPEEAKGALVDCTDVVKG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGACGGTGCTCTTCTCTGCTCCTAGCCGGCCTACAGCTTCTCGCCTTAGCCAACTCAACCTACATCGCTCAACCTCGAGACATCGCCCACGACGTCGGTACTTCAAGTCTCATT
CGACCAACCCAACAACACTCAGAACATCGACGGAGTCTGCCCCTCAGTCTGGAAAGACATCCGCTCCGAACTCTGGACTCGCTTCCAGGGCTGCACCCGCGGCGCCTCCTTCGCCATCCG
CTTCGCCTTCCACGACGCCGCCACTACCTCCCTCCAAACTCCCTATTACGCCCCAGCGTCCGGGGGCGCCGACGGTAGCCTGCTCCTCTCCGATGAAGAATCCGCCCGCTCAGAGAACAA
CCCCCTCCAAGCTTTCCGCTCCAACCTCTCCGCCATCTACGACGCCTACAAACCACACATCGGCGCCGCGGACCTCGTTCAGTTCGCGGGGAGTCTGGGCATATATGCCTGCTCTGGGGG
ACCTCTGATCAAGACCGTCGTGGGGAGGAAAGATAGCGCCGCCGCCGCGCCGCCGAACCTCCTCCCCTCTGCATTTGGCCCTGGCGCGGACGCAGACGTCCTCCTCTCCCTCTTCGCGGA
CAAAGGCTTCTCTCCTCAAGACCTCTCCGCGCTGGTCGGCGCCCACACCGTCTCGCAATCCTTCGCGCAGCAAGCGAACCACATCCCCGTGGGCGGACAGCAGGACACGACCCCGACGAA
GTGGGATGTCGTATTCTATCAGGAGGCTGTCGCGGGAAAGGGGGCGCGGCCGAGGGCGTTTCAGTTCGATAGTGATGTGAATCTTGCGAGGGGCAATGAGACGAAGGGGTACTTTGAACA
GTTCGCGGCAAATAAGGGGTCATGGGATGAGGCTTTTGTGAGGGCGATGGAGAAGATGAGTTTGCTTGGGGTGCCGGAGGAGGCAAAGGGGGCGTTGGTGGATTGTACGGATGTTGTTAA
GGGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGACGGTGCTCTTCTCTGCTCCTAGCCGGCCTACAGCTTCTCGCCTTAGCCAACTCAACCTACATCGCTCAACCTCGAGACATCGCCCACGACGTCGTCTGGAAAGACATCCGC
TCCGAACTCTGGACTCGCTTCCAGGGCTGCACCCGCGGCGCCTCCTTCGCCATCCGCTTCGCCTTCCACGACGCCGCCACTACCTCCCTCCAAACTCCCTATTACGCCCCAGCGTCCGGG
GGCGCCGACGGTAGCCTGCTCCTCTCCGATGAAGAATCCGCCCGCTCAGAGAACAACCCCCTCCAAGCTTTCCGCTCCAACCTCTCCGCCATCTACGACGCCTACAAACCACACATCGGC
GCCGCGGACCTCGTTCAGTTCGCGGGGAGTCTGGGCATATATGCCTGCTCTGGGGGACCTCTGATCAAGACCGTCGTGGGGAGGAAAGATAGCGCCGCCGCCGCGCCGCCGAACCTCCTC
CCCTCTGCATTTGGCCCTGGCGCGGACGCAGACGTCCTCCTCTCCCTCTTCGCGGACAAAGGCTTCTCTCCTCAAGACCTCTCCGCGCTGGTCGGCGCCCACACCGTCTCGCAATCCTTC
GCGCAGCAAGCGAACCACATCCCCGTGGGCGGACAGCAGGACACGACCCCGACGAAGTGGGATGTCGTATTCTATCAGGAGGCTGTCGCGGGAAAGGGGGCGCGGCCGAGGGCGTTTCAG
TTCGATAGTGATGTGAATCTTGCGAGGGGCAATGAGACGAAGGGGTACTTTGAACAGTTCGCGGCAAATAAGGGGTCATGGGATGAGGCTTTTGTGAGGGCGATGGAGAAGATGAGTTTG
CTTGGGGTGCCGGAGGAGGCAAAGGGGGCGTTGGTGGATTGTACGGATGTTGTTAAGGGGTGA

Retrieve as FASTA