Entry information : GmarCIIBB04
Entry ID 11889
Creation 2013-05-23 (Nizar Fawal)
Last sequence changes 2013-05-23 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: GmarCIIBB04
Name GmarCIIBB04
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarCIIBB04
start..stop
S start..stop
GmarCIIBB05 589 0 21..349 15..343
GmarCIIBB03 582 0 1..361 1..361
HsubCIIBB08 476 1.61e-169 1..360 1..361
HsubCIIBB01 461 1.23e-163 1..360 1..362
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11889' 'complement(join(2695910..2695922,2695974..2695998,2696063..2696102,2696154..2696252,2696303..2696379,2696435..2696480,2696532..2696601,2696659..2696704,2696764..2696798,2696848..2697090,2697144..2697284,2697336..2697394,2697447..2697574,2697624..2697684))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2697624..2697684 59 N° 2 2697447..2697574 126 N° 3 2697336..2697394 57 N° 4 2697144..2697284 139
N° 5 2696848..2697090 241 N° 6 2696764..2696798 33 N° 7 2696659..2696704 44 N° 8 2696532..2696601 68
N° 9 2696435..2696480 44 N° 10 2696303..2696379 75 N° 11 2696154..2696252 97 N° 12 2696063..2696102 38
N° 13 2695974..2695998 23 N° 14 2695910..2695922 11  
complement(join(2695910..2695922,2695974..2695998,2696063..2696102,2696154..2696 252,2696303..2696379,2696435..2696480,2696532..2696601,2696659..2696704,2696764. .2696798,2696848..2697090,2697144..2697284,2697336..2697394,2697447..2697574,269 7624..2697684))


exon

Literature and cross-references GmarCIIBB04
DNA ref. JGI genome:   scaffold_3 (2697684..2695910)
Cluster/Prediction ref. JGI gene:   263611
Protein sequence: GmarCIIBB04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (339)
PWM (Da):   %s   37246.77 (34946.5)  
PI (pH):   %s   5.09 (4.79) Peptide Signal:   %s   cut: 22 range:22-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFRKVLSALLFALPLVSVNGLRTKRATCPDGVHTATNAKCCFLFPIVQDLSANLFDGDCGDEAHGALRLMFHDAIGFSPKAGGGGADGSIAVFNKTELTFPANAGIDDILDVIGPFLQK
YSSVMTPGDFIQLAGAVSLSHCAGAPRVKFSLGRPAPKVASPPNLVPDPSDNVAKILGRFGEVGFSPAEVVALLASHSVAGADDVDPTIPGTPFDSTPDIFDTQFFVDVQLRGTKFPGAG
ANAGEVQSGIAGELRLQSDHNFARDSSTSCIFQGFVNQQSKLQSAFGAALFKLSLLGQNTAAMTDCSEVIPQPPALTGSSARFPPGKSMADIEQACASTPFPTLPTVPGPPTAVPPIPQS
*

Retrieve as FASTA  
Remarks complete sequence from genomics (13 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCAGGAAGGTGCTCTCTGCTCTCCTTTTCGCTCTCCCGCTGGTTTCTGTCAATGGTAAGTGTTTCTCCTAGCGGACGAATGCGTAATCTGAGTATCGCTGCAGGTGTCTGAGA
ACAAAACGCGCAACCTGTCCCGACGGTGTTCATACCGCGACAAACGCGAAATGTTGCTTCCTCTTCCCCATCGTACAGGATTTATCCGCCAATTTGTTCGACGGCGACTGCGGTGACGAG
GTCAGTTATTCTAACACCATAGTAATATCTTCAAAAATTAATCTCATTATAGGCGCTCACGGTGCTCTCCGCCTTATGTTCCACGACGCTATTGGATTTTCTCCGAAAGCTGGGTATATA
AATTATTAATATCAAGCAAACCAATACTCAAGAAGTTTAAACAGCGCGGCGGTGGCGCAGACGGCTCTATCGCCGTTTTTAACAAGACGGAACTGACCTTCCCCGCCAATGCTGGCATTG
ACGATATCCTCGACGTTATCGGACCTTTCTTGCAAAAATACTCCAGCGTCATGACACCGGGAGACTT
GTGGGTCTATATCCTCCAAAATAAATTGAGAAAACTAAAACTCCTTCCTTTAG
CACATCCAACTTGCCGGTGCGGTCAGTCTTTCCCACTGTGCGGGAGCTCCTCGTGTCAAATTCTCGCTTGGACGACCAGCACCGAAGGTCGCATCGCCTCCAAATCTTGTCCCTGACCCT
TCCGATAATGTTGCCAAGATTTTGGGGCGTTTCGGTGAAGTAGGCTTCTCCCCTGCCGAGGTAGTAGCTCTCCTTGCGTCTCACAGCGTAGCAGGCGCGGACGACGTTGACCCGACCATC
CCCGG
GTAGGTCTTCCCGCCAGACAGCTGAGGCACTCTTCTAATTTGTTTCCAGAAAACCCCATTCGATTCGACGCCTGATATCTTCGACAGTAAGATATCTACATCAAACCCTACACTA
CGACAAGCACTGACATATTATGGTTTTCAGCTCTCAATTCTTTGTCGACGTACAACTTCGCGGCACCAAGTTCCCAGGGTACGTGAAATGGAATCTTCGAATTATGACTTTTTTTCACGA
TGACGCTTTCAACAGTGTGCGGGTGCTAACGCAGGAGAAGTACAGTCAGGAATCGCGGGTGAATTGCGCTTGCAATCCGACCATAACGTGAGTTACTTGAATTATTCACCTTTTCGTTCT
TAACCCTCCATTTCAAAGTTTTTGCCCGTGACTCGTCTACCAGCTGCATCTTCCAGGGTTTCGTCAGTAAGTCATTTTCTCTTACTTAACTTGACCGCGGTTTAAGCGAACCGAATTTTA
GACACCAACAGTCTAAGCTACAATCGGCTTTCGGCGCCGCCCTATTCAAACTGTCTCTTTTGGGCCAAAACACAGCTGCTGTAGGTGGTAGACGCTGAATCTTTCCACGGGTCATTGACA
TTTTCATTAGATATGACCGATTGCAGCGAGGTGATTCCCCAACCCCCGGCGCTCACTGGCAGTTCAGCGAGATTCCCTCCCGGGAAATCAATGGCTGACATTGAGCAGGCAGTACGTTGG
TTTGCTTCCTGTCCTTCACCCAGATATTGATTTTGTGATTAGTGTGTGCCTCGACACCATTCCCCACTCTACCGACTGTACCAGGTATGTTTCCTGTGAATTTATACCCGCTAACAAGTC
CAAGTTCTTATCGAATTTTCTTTCATAGGAGACCTCCCACTGCCGTGCCCCCCATGTACGTTTATACTCATAAGTTTTTTTCTCCCCGACTAACCATCTAATGTAGCCCCCTCAATCTTA
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCAGGAAGGTGCTCTCTGCTCTCCTTTTCGCTCTCCCGCTGGTTTCTGTCAATGGTCTGAGAACAAAACGCGCAACCTGTCCCGACGGTGTTCATACCGCGACAAACGCGAAA
TGTTGCTTCCTCTTCCCCATCGTACAGGATTTATCCGCCAATTTGTTCGACGGCGACTGCGGTGACGAG
GCTCACGGTGCTCTCCGCCTTATGTTCCACGACGCTATTGGATTTTCTCCG
AAAGCTGG
CGGCGGTGGCGCAGACGGCTCTATCGCCGTTTTTAACAAGACGGAACTGACCTTCCCCGCCAATGCTGGCATTGACGATATCCTCGACGTTATCGGACCTTTCTTGCAAAAA
TACTCCAGCGTCATGACACCGGGAGACTT
CATCCAACTTGCCGGTGCGGTCAGTCTTTCCCACTGTGCGGGAGCTCCTCGTGTCAAATTCTCGCTTGGACGACCAGCACCGAAGGTCGCA
TCGCCTCCAAATCTTGTCCCTGACCCTTCCGATAATGTTGCCAAGATTTTGGGGCGTTTCGGTGAAGTAGGCTTCTCCCCTGCCGAGGTAGTAGCTCTCCTTGCGTCTCACAGCGTAGCA
GGCGCGGACGACGTTGACCCGACCATCCCCGG
AACCCCATTCGATTCGACGCCTGATATCTTCGACACTCAATTCTTTGTCGACGTACAACTTCGCGGCACCAAGTTCCCAGGTGCGGGT
GCTAACGCAGGAGAAGTACAGTCAGGAATCGCGGGTGAATTGCGCTTGCAATCCGACCATAAC
TTTGCCCGTGACTCGTCTACCAGCTGCATCTTCCAGGGTTTCGTCAACCAACAGTCT
AAGCTACAATCGGCTTTCGGCGCCGCCCTATTCAAACTGTCTCTTTTGGGCCAAAACACAGCTGCT
ATGACCGATTGCAGCGAGGTGATTCCCCAACCCCCGGCGCTCACTGGCAGTTCA
GCGAGATTCCCTCCCGGGAAATCAATGGCTGACATTGAGCAGGCA
TGTGCCTCGACACCATTCCCCACTCTACCGACTGTACCAGGACCTCCCACTGCCGTGCCCCCCATCCCTCAATCT
TAA

Retrieve as FASTA