Entry information : GmarAPx-CcP01
Entry ID 11894
Creation 2013-05-24 (Nizar Fawal)
Last sequence changes 2013-05-24 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarAPx-CcP01
Name GmarAPx-CcP01
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarAPx-CcP01
start..stop
S start..stop
GmarAPx-CcP06 830 0 11..476 7..479
GmarAPx-CcP02 718 0 1..467 1..469
GmarAPx-CcP08 704 0 99..476 33..410
GmarAPx-CcP03 528 0 26..466 19..458
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 974861..975097 237 N° 2 975150..975236 87 N° 3 975292..975358 67 N° 4 975413..975725 313
N° 5 975775..975894 120 N° 6 975950..976124 175 N° 7 976177..976620 444  
join(974861..975097,975150..975236,975292..975358,975413..975725,975775..975894, 975950..976124,976177..976620)


exon

Literature and cross-references GmarAPx-CcP01
DNA ref. JGI genome:   scaffold_10 (974861..976620)
Cluster/Prediction ref. JGI gene:   65948
Protein sequence: GmarAPx-CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   480 (456)
PWM (Da):   %s   52227.08 (49455.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.56 (5.56) Peptide Signal:   %s   cut: 25 range:25-480
Sequence 522
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPATTFLSYILWIFSIPVISFVSAEYTWPSAQHDALEQFLYEGTHVTDDNVAGLAGFCLHRALPGGFQPSTFAAEWVRLAYHDMATHNATDGTGGLDASIFYELDRPENIGAGNVNSIGDFKGHSSKLVSRSDIIAMGVIWGVAACGGPPIPFRYGRKDALRAGRSGVPEPQQDLASHIESFRLQGFTQKEMIALVACGHTLGGVRSVDFQDIVPDPSNSSIATFDTTSSFDHLIATQYLNSSTKNPLIRVPSGNMTFASDLRIFSSDRNATMKGLNSETSFFQTCSTLLAKMIDTIPSNVHLSDVVTLLPVKVSNAQITAIDSQLVFMADLRVTFPIDINPMAVSKVRMLWCDSRGQFKNCNRVTNVASLPFLDAADTSPLTDSFNIQFALYRFKVQISAARSVSKFWFEIDGVVHNNGGKGYPIGQDEIIFVPSLGSVDQKFPQPDPANPSEFLPTSYNLVFGVSDTLSIANTFSKSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCCTGCTACCACTTTCCTCAGCTATATTCTCTGGATTTTCTCCATACCGGTGATTTCATTCGTCTCAGCCGAATATACCTGGCCGTCGGCTCAGCATGATGCCCTCGAACAATTTCTAT
ACGAAGGCACCCATGTAACCGATGACAACGTCGCCGGTTTAGCAGGTTTCTGCCTCCACAGAGCCCTCCCTGGAGGATTTCAGCCGTCTACGTTCGCTGCTGAATGGGTACGCCTA
GTAA
GTGTATTCGTCAATCAAAGGGACCTGCGAAACATGACGATTTTAATAGGCGTACCATGATATGGCCACTCATAATGCCACTGACGGCACTGGTGGGTTGGATGCTTCGATTTTCTATGAG
CTCGATAGACCAGAG
GTAAAAGACTCCGATATATGACTTTAAAATCCTACTCAATTTCCTTATCTTACAGAACATCGGTGCCGGAAACGTCAACTCGATTGGGGATTTCAAAGGCCATTC
AAGTAAACTTGTATCTA
GTAAGAGACCCCTACCTCAAACCGTCCTTGAAAACTGAACTGTCCAATTCAAAGGATCTGATATTATTGCGATGGGCGTCATCTGGGGCGTCGCAGCATGTGG
TGGGCCACCGATACCCTTTCGATATGGAAGGAAAGACGCCTTGAGAGCCGGAAGATCTGGGGTCCCAGAGCCACAACAAGATCTTGCTAGCCATATAGAAAGTTTCCGTCTTCAAGGATT
CACGCAAAAAGAGATGATTGCACTCGTCGCATGCGGACATACTCTCGGAGGCGTCAGGAGCGTTGACTTTCAAGATATCGTACCTGATCCATCAAATTCTAGTATCGCGACGTTCGATAC
TACGTCCAGCTTTGATCATCTCAT
GTACGAATTCCTGCTAAGAAATTCGGCTGATGCTAATCCACCGTTTTAGTGCCACACAATACTTAAACTCGTCCACTAAAAATCCATTGATCAGGG
TGCCATCAGGAAATATGACGTTCGCATCGGATTTGCGTATATTCAGCAGTGACCGAAACGCCACCATGAAAGG
GTATGTCGAACCCTACACCTAGAAGCTATTTCATCCACTAATCAGTG
TACTGTAGACTCAATTCCGAGACATCTTTCTTCCAGACTTGTTCGACACTACTAGCCAAGATGATCGACACTATACCTTCAAATGTCCACCTGAGTGATGTAGTCACCCTCCTTCCGGTG
AAAGTGTCCAACGCACAAATCACAGCAATCGATTCACAGCTCGTTTTTATGGCTGACCTCAGA
GTACTTTCGCGTTAACCCGGGCAAACTTGACAATGTCTAATTGATCTTTCAGGTGAC
CTTTCCGATTGACATTAATCCTATGGCAGTCAGTAAAGTCCGGATGTTGTGGTGCGACAGCCGTGGCCAATTCAAGAACTGTAATCGAGTCACCAATGTTGCATCGCTCCCATTCTTGGA
CGCAGCAGACACATCTCCCTTAACCGATTCATTTAATATCCAATTCGCTTTGTACAGATTCAAGGTCCAGATTTCAGCCGCTCGATCTGTCTCGAAGTTCTGGTTTGAAATTGATGGTGT
TGTCCACAACAACGGAGGCAAAGGCTACCCCATAGGTCAAGACGAAATCATATTTGTGCCGTCGTTGGGGAGCGTAGACCAGAAATTTCCCCAACCTGATCCAGCAAATCCATCTGAATT
TTTGCCGACAAGCTATAACCTGGTTTTTGGTGTAAGCGATACCCTCTCAATCGCCAATACGTTTTCTAAGTCATCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCCTGCTACCACTTTCCTCAGCTATATTCTCTGGATTTTCTCCATACCGGTGATTTCATTCGTCTCAGCCGAATATACCTGGCCGTCGGCTCAGCATGATGCCCTCGAACAATTTCTAT
ACGAAGGCACCCATGTAACCGATGACAACGTCGCCGGTTTAGCAGGTTTCTGCCTCCACAGAGCCCTCCCTGGAGGATTTCAGCCGTCTACGTTCGCTGCTGAATGGGTACGCCTA
GCGT
ACCATGATATGGCCACTCATAATGCCACTGACGGCACTGGTGGGTTGGATGCTTCGATTTTCTATGAGCTCGATAGACCAGAG
AACATCGGTGCCGGAAACGTCAACTCGATTGGGGATT
TCAAAGGCCATTCAAGTAAACTTGTATCTA
GATCTGATATTATTGCGATGGGCGTCATCTGGGGCGTCGCAGCATGTGGTGGGCCACCGATACCCTTTCGATATGGAAGGAAAGACGCCT
TGAGAGCCGGAAGATCTGGGGTCCCAGAGCCACAACAAGATCTTGCTAGCCATATAGAAAGTTTCCGTCTTCAAGGATTCACGCAAAAAGAGATGATTGCACTCGTCGCATGCGGACATA
CTCTCGGAGGCGTCAGGAGCGTTGACTTTCAAGATATCGTACCTGATCCATCAAATTCTAGTATCGCGACGTTCGATACTACGTCCAGCTTTGATCATCTCAT
TGCCACACAATACTTAA
ACTCGTCCACTAAAAATCCATTGATCAGGGTGCCATCAGGAAATATGACGTTCGCATCGGATTTGCGTATATTCAGCAGTGACCGAAACGCCACCATGAAAGG
ACTCAATTCCGAGACAT
CTTTCTTCCAGACTTGTTCGACACTACTAGCCAAGATGATCGACACTATACCTTCAAATGTCCACCTGAGTGATGTAGTCACCCTCCTTCCGGTGAAAGTGTCCAACGCACAAATCACAG
CAATCGATTCACAGCTCGTTTTTATGGCTGACCTCAGA
GTGACCTTTCCGATTGACATTAATCCTATGGCAGTCAGTAAAGTCCGGATGTTGTGGTGCGACAGCCGTGGCCAATTCAAGA
ACTGTAATCGAGTCACCAATGTTGCATCGCTCCCATTCTTGGACGCAGCAGACACATCTCCCTTAACCGATTCATTTAATATCCAATTCGCTTTGTACAGATTCAAGGTCCAGATTTCAG
CCGCTCGATCTGTCTCGAAGTTCTGGTTTGAAATTGATGGTGTTGTCCACAACAACGGAGGCAAAGGCTACCCCATAGGTCAAGACGAAATCATATTTGTGCCGTCGTTGGGGAGCGTAG
ACCAGAAATTTCCCCAACCTGATCCAGCAAATCCATCTGAATTTTTGCCGACAAGCTATAACCTGGTTTTTGGTGTAAGCGATACCCTCTCAATCGCCAATACGTTTTCTAAGTCATCCT
GA

Retrieve as FASTA