Entry information : HEC38CIIAB01
Entry ID 11933
Creation 2013-05-28 (Nizar Fawal)
Last sequence changes 2013-05-28 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-25 (Catherine Mathe (Scipio))
Peroxidase information: HEC38CIIAB01
Name HEC38CIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. EC38    [TaxId: 1001937 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HEC38CIIAB01
start..stop
S start..stop
HCO27CIIAB01 515 0 1..268 1..268
DescCIIAB01 427 2.68e-153 1..268 1..272
HC14CIIAB01 402 1.76e-143 1..268 1..268
RrufCIIAB01 309 4.1e-106 21..263 31..273
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11933' 'complement(join(125572..125653,125714..126101,126170..126503))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 126170..126503 332 N° 2 125714..126101 386 N° 3 125572..125653 80  
complement(join(125572..125653,125714..126101,126170..126503))


exon

Literature and cross-references HEC38CIIAB01
DNA ref. JGI genome:   scaffold_29 (126503..125572)
Cluster/Prediction ref. JGI gene:   70247
Protein sequence: HEC38CIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267 (245)
PWM (Da):   %s   27426.05 (25093.8)  
PI (pH):   %s   3.78 (3.63) Peptide Signal:   %s   cut: 23 range:23-267
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSFKPTIILAALVAHCGLARAQCPSVWTDVAADLKLTFLDTDGNCNDDARAAIRLAFHDCFPGSCDGSIILADECTERGENTQLVDICSTLSDKATLFDVGTADLIQFAAAFGIASCPG
LPAISVKVGRTDSSTASPTGQMPSASDNATSIVAAFAAKGFSTTELVALIGAHSAAKDLDGNALDSTVDDLDTNFYTETADGTAPASLDSDVSLSNSTETSADWNTFGADASAWADAFVP
AMEKLSLLGNDEASLTDCSSVITEAFA*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCGTTTAAACCTACCATCATACTCGCAGCTCTCGTTGCTCATTGTGGCCTCGCTAGAGCGCAATGTCCATCAGTCTGGACGGATGTTGCTGCAGACTTGAAACTCACTTTCTTG
GATACCGATGGGAACTGCAACGATGATGCTCGTGCAGCTATTCGGCTCGCGTTCCACGACTGCTTCCCAGGGTCTTGCGACGGATCTATAATTCTTGCAGACGAGTGCACGGAGCGTGGC
GAGAACACTCAACTTGTCGATATATGCTCTACTCTGAGTGACAAAGCAACCCTGTTCGATGTCGGTACTGCCGATTTAATCCAGTTCGCCGCAG
GTGAGTTTTTCACTACTTGCTCTAAT
ATCTATGCCCCTTGACTTACGCAGATATTCGAATGTATCTAGCACATTCGGAATTGCCTCATGCCCGGGGCTACCAGCTATATCTGTCAAGGTTGGCAGAACAGATTCATCTACGGCAAG
CCCAACGGGTCAAATGCCGTCAGCCAGTGACAACGCAACTTCCATAGTCGCTGCATTTGCTGCGAAGGGCTTCTCAACCACTGAATTGGTTGCTCTTATTGGAGCCCACAGCGCTGCTAA
GGACCTGGACGGAAACGCGCTCGACTCTACTGTGGATGACCTGGACACAAACTTCTACACCGAAACCGCCGACGGAACTGCCCCCGCTAGTTTAGATAGCGACGTTTCTCTTAGCAACTC
AACGGAAACGAGCGCTGACTGGAATACTTTCGGCGCCGATGCTTCCGCGTGGGCCGATGCATTTGTTCCAGC
GTGAGTATTCTCCCATCTAACAAATATAATTTCGATTTAGTTGCTAAT
TCTCCCGCGCAGAAAATGGAAAAGCTTAGCCTCCTTGGTAACGATGAGGCTAGCTTGACTGATTGCTCTAGTGTCATTACAGAGGCATTCGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCGTTTAAACCTACCATCATACTCGCAGCTCTCGTTGCTCATTGTGGCCTCGCTAGAGCGCAATGTCCATCAGTCTGGACGGATGTTGCTGCAGACTTGAAACTCACTTTCTTG
GATACCGATGGGAACTGCAACGATGATGCTCGTGCAGCTATTCGGCTCGCGTTCCACGACTGCTTCCCAGGGTCTTGCGACGGATCTATAATTCTTGCAGACGAGTGCACGGAGCGTGGC
GAGAACACTCAACTTGTCGATATATGCTCTACTCTGAGTGACAAAGCAACCCTGTTCGATGTCGGTACTGCCGATTTAATCCAGTTCGCCGCAG
CATTCGGAATTGCCTCATGCCCGGGG
CTACCAGCTATATCTGTCAAGGTTGGCAGAACAGATTCATCTACGGCAAGCCCAACGGGTCAAATGCCGTCAGCCAGTGACAACGCAACTTCCATAGTCGCTGCATTTGCTGCGAAGGGC
TTCTCAACCACTGAATTGGTTGCTCTTATTGGAGCCCACAGCGCTGCTAAGGACCTGGACGGAAACGCGCTCGACTCTACTGTGGATGACCTGGACACAAACTTCTACACCGAAACCGCC
GACGGAACTGCCCCCGCTAGTTTAGATAGCGACGTTTCTCTTAGCAACTCAACGGAAACGAGCGCTGACTGGAATACTTTCGGCGCCGATGCTTCCGCGTGGGCCGATGCATTTGTTCCA
GC
AATGGAAAAGCTTAGCCTCCTTGGTAACGATGAGGCTAGCTTGACTGATTGCTCTAGTGTCATTACAGAGGCATTCGCCTAA

Retrieve as FASTA