Entry information : HEC38APx-CcP03
Entry ID 11935
Creation 2013-05-28 (Nizar Fawal)
Last sequence changes 2013-05-28 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-25 (Catherine Mathe (Scipio))
Peroxidase information: HEC38APx-CcP03
Name HEC38APx-CcP03
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. EC38    [TaxId: 1001937 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HEC38APx-CcP03
start..stop
S start..stop
HCO27APx-CcP03 1601 0 1..810 1..828
HC14APx-CcP04 1338 0 1..808 1..828
HC14APx-CcP04 122 1.26e-28 584..702 714..830
XhypAPx-CcP01 1076 0 1..795 1..795
XhypAPx-CcP01 171 2.8e-44 594..792 820..1010
DescAPx-CcP02 917 0 14..545 4..535
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11935' 'complement(join(162153..162652,162711..162891,162946..163362,163416..163604,163663..164805))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 163663..164805 1141 N° 2 163416..163604 187 N° 3 162946..163362 415 N° 4 162711..162891 179
N° 5 162153..162652 498  
complement(join(162153..162652,162711..162891,162946..163362,163416..163604,1636 63..164805))


exon

Literature and cross-references HEC38APx-CcP03
DNA ref. JGI genome:   scaffold_58 (164805..162153)
Cluster/Prediction ref. JGI gene:   74443
Protein sequence: HEC38APx-CcP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   809 (789)
PWM (Da):   %s   85550.63 (83239.4)  
PI (pH):   %s   4.22 (4.17) Peptide Signal:   %s   cut: 21 range:21-809
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHWAVVYWGAILSLGTVARTDPTWPSSNDELEEIMYQVKGYRGRNFGGTVIPCSNEASGPGRQNAAEWLRAAFHDMATTTDLGGVRSGGLDGSLQYELTSSDNLGPGFNTTLKFMADYYT
SRSGVADLIALGVYYAVRSCGGPGVPVAGGRVDAVAGGPIGVPLPQNTAFTFEQQFIRMGFNKTEMIQVTACGHSIGGVHEDEFPEIVPVGSTSNGEAPLDSTVATFDNKIVTEYIDGNT
TNPMVVGPSVKATRNADFKVFSYDGNVTVKAMSGATDFNNICATVLQKMIETVPDGVILSDPIEPYFVKPVDMQLALSPGATTMQLTGFIRVRTTELGGDSVSSLTLNYKDRSGGDNCGS
ASCEYTATLLGATQGFDDQFVWFPIDASISTSTGISSFTLTLNMASGTTQTFDNNGNSYPMQDAILIQKPQSCLLSGTLTVTAAVRNDRKSLPVNMFLSYKTPTGNPNLPVPTLKNATVA
MTEAICVGSYTLYTANYTDLGDLAYATKIDVISGSGTSALTDDFNAASDLGGTCQAFQDPPSSLCTTGPASAPPDSSITSSIGSTSSSSSITDITTLTSSSLPTLHHRQDLGEYVLVGCQ
KESTVVGSRALSGASFAYDSMTLESCLKNCTGYIYWGTEYGRECYCGDSLHSTSEDAPLTDCNMVCGGDATEYCGDSNRIELYSTTASQPAPTATLALKPTVSSYVRVGCYIEIQNGRAL
TGATYAYDAMTLETCASNCTGFTYWGTEYSRECYCGNTLDSRSTLVPDADCNMVCGGDHYEYCGAGMRLELYQLVTASTSLAAITSSPV*

Retrieve as FASTA  
Remarks complete sequence from genomics ( 4 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTGGGCCGTTGTCTACTGGGGTGCCATACTGTCCTTGGGTACCGTCGCGAGGACAGACCCAACCTGGCCCTCCTCTAATGACGAGCTCGAGGAGATTATGTACCAAGTTAAGGGT
TACAGGGGAAGAAACTTTGGCGGTACCGTCATACCATGCTCCAATGAAGCATCCGGACCTGGTCGACAAAACGCTGCGGAGTGGTTACGAGCAGCGTTCCATGATATGGCCACAACTACT
GATTTGGGTGGCGTGCGATCCGGTGGGCTGGACGGGTCTTTGCAGTATGAGTTGACCAGCTCAGACAACCTCGGTCCAGGCTTCAACACGACTCTCAAATTCATGGCTGACTATTATACG
AGCCGATCAGGTGTAGCGGATCTCATTGCTCTGGGAGTATATTATGCCGTGAGGTCTTGCGGTGGCCCTGGGGTACCTGTAGCTGGTGGGAGGGTCGACGCCGTGGCAGGCGGTCCTATA
GGTGTCCCATTACCACAGAACACTGCCTTCACCTTTGAGCAGCAGTTTATTCGGATGGGCTTCAACAAGACCGAGATGATTCAAGTCACCGCCTGCGGTCATTCTATTGGTGGTGTTCAC
GAAGATGAATTTCCAGAGATTGTCCCGGTTGGATCTACTTCAAACGGCGAAGCTCCCTTGGACTCGACTGTCGCTACGTTCGATAACAAGATCGTCACCGAATACATTGATGGCAACACA
ACTAATCCCATGGTGGTTGGGCCATCTGTCAAGGCTACTAGGAATGCGGACTTCAAGGTGTTCAGTTACGATGGAAATGTGACGGTCAAAGCCATGTCAGGTGCTACGGACTTCAATAAT
ATATGCGCTACTGTTCTTCAGAAGATGATTGAAACAGTGCCCGACGGCGTAATTCTGTCGGACCCCATCGAGCCATATTTTGTCAAGCCAGTTGATATGCAGTTGGCGCTAAGCCCTGGT
GCTACTACAATGCAATTGACAGGCTTCATACGCGTTCGAACAACAGAATTGGGTGGAGATTCAGTCTCGAGCTTGACGTTAAATTACAAAGACAGAAGTGGAGGTGACAACTGCGGTAGC
GCAAGTTGCGAATATACGGCAACTCTTTTGGGTGCTACTCAGGGCTTCGATGATCAATTTGTT
GTAAGTCTGGGGAACAGTTTGTGGTTGTCTTAACCAGTCGAGACCTGACATATCTAA
GTGTGGTTTCCTATCGATGCTTCCATCTCGACTTCCACGGGTATTTCATCTTTCACCCTGACCCTCAACATGGCCAGTGGAACGACTCAAACTTTTGATAACAATGGAAATTCGTACCCC
ATGCAGGACGCAATTTTGATTCAAAAACCCCAGAGTTGTCTTCTTTCCGGCACTCTTACTGTCACAGCAGCT
GTGAGCCAACCTTATAAGCTGAACCACAGGCAACTGTTGACATGTTTC
TCTAGGTGTTCGAAATGATCGAAAATCTCTCCCCGTTAACATGTTTCTTTCCTACAAGACCCCAACGGGAAACCCGAATCTTCCAGTGCCTACTCTCAAAAATGCGACGGTCGCTATGAC
CGAAGCGATTTGTGTAGGCTCATATACGCTTTATACCGCTAATTACACAGATCTTGGTGATCTTGCATATGCAACTAAAATCGACGTTATTAGCGGGAGTGGCACCTCGGCTCTAACAGA
CGATTTCAACGCCGCAAGCGACTTGGGAGGCACTTGTCAGGCTTTCCAAGATCCTCCGTCATCCTTGTGTACCACTGGACCGGCGTCGGCGCCTCCCGATTCCTCAATCACATCGTCTAT
AGGAAGCACTTCTTCGTCATCATCCATCACGGATATCACTACGTTGACTTCTTCCTCACTACCT
GTTAGCTCATCTACCACGGCGACCAGCACAAGCACCTCTACAGCACCGACAGAGAC

ACCCTGCACCACAGGCAGGACCTTGGTGAGTATGTGCTTGTAGGGTGTCAGAAAGAGTCGACTGTGGTAGGAAGCCGCGCTCTTAGCGGCGCATCATTCGCCTATGACAGTATGACGCTG
GAGAGTTGTCTGAAGAATTGTACAGGATATATCTACTGGGGTACCGAGTATGGCAGAGAGT
GTAAGCTTTTAAACCCGCGGACGTCGTTAGCGAGAGATGCGACTAACTTTCCATGTAGG
TGTTACTGTGGCGATTCGCTCCACTCAACAAGCGAAGATGCGCCCTTGACCGACTGTAATATGGTCTGCGGCGGAGACGCTACCGAATACTGCGGAGATAGTAATAGAATAGAATTATAC
AGCACTACAGCCAGCCAGCCAGCTCCGACTGCCACACTGGCTCTTAAGCCAACTGTGTCATCGTACGTCCGTGTTGGTTGCTATATCGAAATACAGAACGGTCGGGCCCTGACCGGGGCA
ACTTATGCGTACGACGCTATGACATTGGAAACGTGTGCTTCGAACTGCACAGGCTTTACGTATTGGGGAACGGAATATAGCCGAGAATGCTACTGCGGTAATACTCTGGATAGTCGCAGC
ACACTTGTTCCCGACGCTGACTGTAACATGGTTTGTGGTGGGGATCATTATGAGTACTGCGGAGCTGGAATGAGGCTTGAATTATACCAGCTAGTAACAGCTTCGACATCTCTGGCAGCT
ATCACTTCGAGTCCTGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTGGGCCGTTGTCTACTGGGGTGCCATACTGTCCTTGGGTACCGTCGCGAGGACAGACCCAACCTGGCCCTCCTCTAATGACGAGCTCGAGGAGATTATGTACCAAGTTAAGGGT
TACAGGGGAAGAAACTTTGGCGGTACCGTCATACCATGCTCCAATGAAGCATCCGGACCTGGTCGACAAAACGCTGCGGAGTGGTTACGAGCAGCGTTCCATGATATGGCCACAACTACT
GATTTGGGTGGCGTGCGATCCGGTGGGCTGGACGGGTCTTTGCAGTATGAGTTGACCAGCTCAGACAACCTCGGTCCAGGCTTCAACACGACTCTCAAATTCATGGCTGACTATTATACG
AGCCGATCAGGTGTAGCGGATCTCATTGCTCTGGGAGTATATTATGCCGTGAGGTCTTGCGGTGGCCCTGGGGTACCTGTAGCTGGTGGGAGGGTCGACGCCGTGGCAGGCGGTCCTATA
GGTGTCCCATTACCACAGAACACTGCCTTCACCTTTGAGCAGCAGTTTATTCGGATGGGCTTCAACAAGACCGAGATGATTCAAGTCACCGCCTGCGGTCATTCTATTGGTGGTGTTCAC
GAAGATGAATTTCCAGAGATTGTCCCGGTTGGATCTACTTCAAACGGCGAAGCTCCCTTGGACTCGACTGTCGCTACGTTCGATAACAAGATCGTCACCGAATACATTGATGGCAACACA
ACTAATCCCATGGTGGTTGGGCCATCTGTCAAGGCTACTAGGAATGCGGACTTCAAGGTGTTCAGTTACGATGGAAATGTGACGGTCAAAGCCATGTCAGGTGCTACGGACTTCAATAAT
ATATGCGCTACTGTTCTTCAGAAGATGATTGAAACAGTGCCCGACGGCGTAATTCTGTCGGACCCCATCGAGCCATATTTTGTCAAGCCAGTTGATATGCAGTTGGCGCTAAGCCCTGGT
GCTACTACAATGCAATTGACAGGCTTCATACGCGTTCGAACAACAGAATTGGGTGGAGATTCAGTCTCGAGCTTGACGTTAAATTACAAAGACAGAAGTGGAGGTGACAACTGCGGTAGC
GCAAGTTGCGAATATACGGCAACTCTTTTGGGTGCTACTCAGGGCTTCGATGATCAATTTGTT
TGGTTTCCTATCGATGCTTCCATCTCGACTTCCACGGGTATTTCATCTTTCACCCTG
ACCCTCAACATGGCCAGTGGAACGACTCAAACTTTTGATAACAATGGAAATTCGTACCCCATGCAGGACGCAATTTTGATTCAAAAACCCCAGAGTTGTCTTCTTTCCGGCACTCTTACT
GTCACAGCAGCT
GTTCGAAATGATCGAAAATCTCTCCCCGTTAACATGTTTCTTTCCTACAAGACCCCAACGGGAAACCCGAATCTTCCAGTGCCTACTCTCAAAAATGCGACGGTCGCT
ATGACCGAAGCGATTTGTGTAGGCTCATATACGCTTTATACCGCTAATTACACAGATCTTGGTGATCTTGCATATGCAACTAAAATCGACGTTATTAGCGGGAGTGGCACCTCGGCTCTA
ACAGACGATTTCAACGCCGCAAGCGACTTGGGAGGCACTTGTCAGGCTTTCCAAGATCCTCCGTCATCCTTGTGTACCACTGGACCGGCGTCGGCGCCTCCCGATTCCTCAATCACATCG
TCTATAGGAAGCACTTCTTCGTCATCATCCATCACGGATATCACTACGTTGACTTCTTCCTCACTACCT
ACCCTGCACCACAGGCAGGACCTTGGTGAGTATGTGCTTGTAGGGTGTCAG
AAAGAGTCGACTGTGGTAGGAAGCCGCGCTCTTAGCGGCGCATCATTCGCCTATGACAGTATGACGCTGGAGAGTTGTCTGAAGAATTGTACAGGATATATCTACTGGGGTACCGAGTAT
GGCAGAGAGT
GTTACTGTGGCGATTCGCTCCACTCAACAAGCGAAGATGCGCCCTTGACCGACTGTAATATGGTCTGCGGCGGAGACGCTACCGAATACTGCGGAGATAGTAATAGAATA
GAATTATACAGCACTACAGCCAGCCAGCCAGCTCCGACTGCCACACTGGCTCTTAAGCCAACTGTGTCATCGTACGTCCGTGTTGGTTGCTATATCGAAATACAGAACGGTCGGGCCCTG
ACCGGGGCAACTTATGCGTACGACGCTATGACATTGGAAACGTGTGCTTCGAACTGCACAGGCTTTACGTATTGGGGAACGGAATATAGCCGAGAATGCTACTGCGGTAATACTCTGGAT
AGTCGCAGCACACTTGTTCCCGACGCTGACTGTAACATGGTTTGTGGTGGGGATCATTATGAGTACTGCGGAGCTGGAATGAGGCTTGAATTATACCAGCTAGTAACAGCTTCGACATCT
CTGGCAGCTATCACTTCGAGTCCTGTTTGA

Retrieve as FASTA