Entry information : HEC38GPx01
Entry ID 11936
Creation 2013-05-28 (Nizar Fawal)
Last sequence changes 2016-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-08 (Achraf Jemmat)
Peroxidase information: HEC38GPx01
Name HEC38GPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. EC38    [TaxId: 1001937 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HEC38GPx01
start..stop
S start..stop
HCO27GPx01 513 0 1..249 1..249
DescGPx01 397 6.33e-142 1..249 1..258
HC14GPx 380 1.43e-135 1..244 1..251
HC14GPx01 316 1.67e-111 80..244 1..165
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11936' 'complement(join(230910..231376,231451..231730))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 231451..231730 278 N° 2 230910..231376 465  
complement(join(230910..231376,231451..231730))


exon

Literature and cross-references HEC38GPx01
DNA ref. JGI genome:   scaffold_5 (231730..230910)
Cluster/Prediction ref. JGI gene:   383262
Protein sequence: HEC38GPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   248 (1544)
PWM (Da):   %s   27975.28 (164299.0)  
PI (pH):   %s   9.93 (4.23) Peptide Signal:   %s   cut: 22 range:22-1565
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTQVVIRSWHPTHSIFNRFCRVTSSNLRSTALSSKRRLASFRYPADESTIATFTSLTSAASTPRHPRHYISTITNTTRTMASATTFYDFKVKDKKGNEKSLADYKGKVVLVVNTASKCGF
TPQYAGLEKLYKDITAKYPDDFVILGFPCNQFGGQEPGTDDDIQSFCQVNYGVTFPIMGKTDVNGDKAEPVFEWMKAEKPGLLGMKRVKWNFEKFLIGRDGKVKERWASTTKPESLEKPI
LEELEKKA*

Retrieve as FASTA  
Remarks Complete sequence from genomics (1 intron). Incorrect prediction from JGI (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACAAGTCGTTATAAGGAGCTGGCATCCCACACATTCAATCTTCAACCGTTTCTGCAGAGTGACTTCATCAAATCTGCGTAGTACAGCCTTATCATCTAAACGTCGATTAGCGAGT
TTCAGATACCCCGCTGACGAGAGCACTATCGCGACTTTTACAAGCTTAACCTCAGCTGCAAGTACCCCGCGACATCCGAGACATTATATCTCTACCATCACCAACACAACCCGCACAATG
GCTTCAGCTACGACATTCTACGACTTCAAGGTCAAGGACA
GTACGTAATGCCGAACCAATACTTACTTAGGTACCATATAAACATATGCTAACAACCGCTACTCTTACCACCAGAGAGAA
GGGTAACGAGAAGTCCTTAGCCGACTACAAGGGCAAAGTAGTACTAGTCGTAAACACAGCGTCCAAGTGCGGCTTCACACCGCAATACGCCGGACTCGAAAAGCTATACAAGGATATCAC
GGCGAAGTACCCCGATGATTTCGTTATCCTAGGCTTCCCATGCAACCAGTTCGGCGGCCAGGAACCCGGCACCGACGATGACATCCAGAGCTTCTGCCAGGTCAACTACGGCGTAACGTT
CCCCATCATGGGCAAGACAGACGTGAACGGCGACAAGGCCGAGCCGGTGTTCGAGTGGATGAAGGCCGAGAAGCCCGGGCTCCTGGGCATGAAGCGCGTGAAGTGGAACTTCGAGAAGTT
CCTCATCGGAAGGGACGGCAAGGTCAAGGAGCGGTGGGCCAGTACCACCAAGCCGGAGAGTTTGGAGAAGCCTATCTTGGAGGAGCTGGAGAAGAAGGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACAAGTCGTTATAAGGAGCTGGCATCCCACACATTCAATCTTCAACCGTTTCTGCAGAGTGACTTCATCAAATCTGCGTAGTACAGCCTTATCATCTAAACGTCGATTAGCGAGT
TTCAGATACCCCGCTGACGAGAGCACTATCGCGACTTTTACAAGCTTAACCTCAGCTGCAAGTACCCCGCGACATCCGAGACATTATATCTCTACCATCACCAACACAACCCGCACAATG
GCTTCAGCTACGACATTCTACGACTTCAAGGTCAAGGACA
AGAAGGGTAACGAGAAGTCCTTAGCCGACTACAAGGGCAAAGTAGTACTAGTCGTAAACACAGCGTCCAAGTGCGGCTTC
ACACCGCAATACGCCGGACTCGAAAAGCTATACAAGGATATCACGGCGAAGTACCCCGATGATTTCGTTATCCTAGGCTTCCCATGCAACCAGTTCGGCGGCCAGGAACCCGGCACCGAC
GATGACATCCAGAGCTTCTGCCAGGTCAACTACGGCGTAACGTTCCCCATCATGGGCAAGACAGACGTGAACGGCGACAAGGCCGAGCCGGTGTTCGAGTGGATGAAGGCCGAGAAGCCC
GGGCTCCTGGGCATGAAGCGCGTGAAGTGGAACTTCGAGAAGTTCCTCATCGGAAGGGACGGCAAGGTCAAGGAGCGGTGGGCCAGTACCACCAAGCCGGAGAGTTTGGAGAAGCCTATC
TTGGAGGAGCTGGAGAAGAAGGCGTAA

Retrieve as FASTA