Entry information : HCO27CIIAB01
Entry ID 11942
Creation 2013-05-28 (Nizar Fawal)
Last sequence changes 2013-05-28 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-25 (Catherine Mathe (Scipio))
Peroxidase information: HCO27CIIAB01
Name HCO27CIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. CO27-5    [TaxId: 1001938 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HCO27CIIAB01
start..stop
S start..stop
HEC38CIIAB01 515 0 1..268 1..268
DescCIIAB01 424 2.35e-152 1..268 1..272
HC14CIIAB01 407 1.73e-145 1..268 1..268
RrufCIIAB01 311 9.01e-107 21..263 31..273
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11942' 'complement(join(162984..163065,163126..163513,163582..163915))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 163582..163915 332 N° 2 163126..163513 386 N° 3 162984..163065 80  
complement(join(162984..163065,163126..163513,163582..163915))


exon

Literature and cross-references HCO27CIIAB01
DNA ref. JGI genome:   scaffold_45 (163915..162984)
Cluster/Prediction ref. JGI gene:   21310
Protein sequence: HCO27CIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267 (245)
PWM (Da):   %s   27429.09 (24978.7)  
PI (pH):   %s   3.79 (3.65) Peptide Signal:   %s   cut: 23 range:23-267
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSFRPTIILATLVAHYGLARAQCPSVWTDVAADLKLTFLDTDGNCNDDARAAIRLAFHDCFPGSCDGSIILADECTGRGENTQLVDICSTLSDKATLFDVGTADLIQFAAAFGIASCPG
LPAISVKVGRTDSSTASPTGQMPSASDNATSIVAAFAAKGFSATELVALIGAHSAAKDLDGNALDSTVDDLDTNFYTETADGTAPASLDSDISLSSSTETSADWNTFGADASAWADAFVP
AMEKLSLLGNDEASLTDCSSVITEAFA*

Retrieve as FASTA  
Remarks complete sequence from genomics (2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCGTTTAGACCTACCATCATACTCGCAACTCTCGTTGCCCATTATGGCCTCGCCAGAGCGCAATGTCCATCAGTCTGGACGGATGTTGCTGCAGACTTGAAACTCACTTTCTTG
GATACCGATGGGAACTGCAACGATGATGCTCGTGCAGCTATTCGGCTCGCCTTCCACGACTGCTTCCCAGGGTCTTGCGACGGATCTATAATTCTCGCAGACGAGTGTACGGGGCGTGGC
GAGAACACTCAACTTGTCGATATATGCTCTACTCTGAGTGACAAAGCAACCCTGTTCGATGTCGGTACCGCCGATTTAATCCAGTTCGCTGCGG
GTGAGTTTTTCACTGCTTGCTCTGAT
ATCTATGCCCCTTGACTTACGTAGATATTCGAATGTATTTAGCACATTCGGAATTGCCTCATGCCCGGGGCTACCAGCTATATCTGTCAAGGTTGGCAGAACAGATTCATCCACGGCAAG
CCCAACGGGCCAAATGCCGTCAGCCAGTGACAACGCAACTTCTATAGTCGCTGCATTTGCTGCGAAGGGCTTCTCAGCCACTGAATTAGTTGCCCTTATTGGAGCCCACAGCGCTGCTAA
GGACCTGGACGGAAACGCGCTCGACTCTACCGTAGACGACTTGGACACAAACTTCTACACCGAGACCGCCGACGGAACTGCCCCTGCTAGTTTGGATAGCGACATTTCTCTCAGCAGCTC
AACGGAAACGAGCGCTGATTGGAATACTTTCGGCGCCGATGCTTCTGCATGGGCTGATGCATTTGTTCCAGC
GTGAGTATTCTCCCATCTAACAAACATTATTTCGATTTAGTTGCTAAT
TCTCCCGCACAGGAGATGGAAAAGCTTAGCCTCCTAGGTAACGATGAGGCTAGCTTGACTGATTGCTCTAGTGTTATTACAGAGGCCTTCGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCGTTTAGACCTACCATCATACTCGCAACTCTCGTTGCCCATTATGGCCTCGCCAGAGCGCAATGTCCATCAGTCTGGACGGATGTTGCTGCAGACTTGAAACTCACTTTCTTG
GATACCGATGGGAACTGCAACGATGATGCTCGTGCAGCTATTCGGCTCGCCTTCCACGACTGCTTCCCAGGGTCTTGCGACGGATCTATAATTCTCGCAGACGAGTGTACGGGGCGTGGC
GAGAACACTCAACTTGTCGATATATGCTCTACTCTGAGTGACAAAGCAACCCTGTTCGATGTCGGTACCGCCGATTTAATCCAGTTCGCTGCGG
CATTCGGAATTGCCTCATGCCCGGGG
CTACCAGCTATATCTGTCAAGGTTGGCAGAACAGATTCATCCACGGCAAGCCCAACGGGCCAAATGCCGTCAGCCAGTGACAACGCAACTTCTATAGTCGCTGCATTTGCTGCGAAGGGC
TTCTCAGCCACTGAATTAGTTGCCCTTATTGGAGCCCACAGCGCTGCTAAGGACCTGGACGGAAACGCGCTCGACTCTACCGTAGACGACTTGGACACAAACTTCTACACCGAGACCGCC
GACGGAACTGCCCCTGCTAGTTTGGATAGCGACATTTCTCTCAGCAGCTCAACGGAAACGAGCGCTGATTGGAATACTTTCGGCGCCGATGCTTCTGCATGGGCTGATGCATTTGTTCCA
GC
GATGGAAAAGCTTAGCCTCCTAGGTAACGATGAGGCTAGCTTGACTGATTGCTCTAGTGTTATTACAGAGGCCTTCGCCTAA

Retrieve as FASTA