Entry information : ClunGPx01
Entry ID 12027
Creation 2013-05-29 (Nizar Fawal)
Last sequence changes 2013-05-29 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: ClunGPx01
Name ClunGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus lunatus (Curvularia lunata)    [TaxId: 5503 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ClunGPx01
start..stop
S start..stop
SturGPx01 325 3.28e-116 1..167 1..167
PtritGPx01 328 5.77e-116 1..165 104..268
PterGPx01 327 1.7e-115 1..165 101..265
CheGPx01_C5 322 6.13e-115 1..166 1..166
Gene structure Fichier Exons


exon

Literature and cross-references ClunGPx01
DNA ref. JGI genome:   scaffold_2 (1598830..1598021)
Cluster/Prediction ref. JGI gene:   142376
Protein sequence: ClunGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18845.67  
PI (pH):   %s   8.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFFDFKPKDKKGQPYDLSKLSGKVVLVVNTASKCGFTPQFEGLEKLYKEIKAKHPDDFEILGFPCNQFGGQDPGSNDEIQEFCQLNYGVSFPVLGKIDVNGSTADPAFEWLKNEK
PGIMGLKRVKWNFEKFLVGRDGKVKGRWASTKKPEDLKAEIEKELAASK*

Retrieve as FASTA  
Remarks complete sequence from genomic (2 introns).
DNA
Send to BLAST
CDS
Send to BLAST