Entry information : Lu2CysPrx23(Lus10004221|PACid:23175399)
Entry ID 12035
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: Lu2CysPrx23(Lus10004221|PACid:23175399)
Name Lu2CysPrx23(Lus10004221|PACid:23175399)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Lu2CysPrx23
start..stop
S start..stop
Pt2CysPrx02 87 9.86e-23 1..95 1..92
Nt2CysPrx02-1A 79 2.1e-19 1..95 1..96
Pt2CysPrx01 76 1.92e-18 1..95 1..98
Hc2CysPrx 71 2.25e-16 1..95 1..101
Gene structure Fichier Exons


exon

Literature and cross-references Lu2CysPrx23(Lus10004221|PACid:23175399)
DNA ref. Phytozome 12:   scaffold555 (150071..150426)
Protein sequence: Lu2CysPrx23(Lus10004221|PACid:23175399)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   96
PWM (Da):   %s   10390.31  
PI (pH):   %s   8.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSAATSASLTFSIPTTKIHACHFTPLQTQPPLPNSLFGLRKPLSQSTFNARSINARNRMKSFVVRASSELPLVGNVAPDFEDEAVFDQEFIKVL*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 3' end is missing.
DNA
Send to BLAST
CDS
Send to BLAST