Entry information : LuAPx104(Lus10019781|PACid:23164073)
Entry ID 12037
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-11 (Qiang Li)
Peroxidase information: LuAPx104(Lus10019781|PACid:23164073)
Name LuAPx104(Lus10019781|PACid:23164073)
Class Ascorbate peroxidase    [Orthogroup: APx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuAPx104
start..stop
S start..stop
LuAPx79 575 0 1..286 1..286
LsaAPx02 480 7.2e-174 1..285 1..285
HaAPx03 475 8.11e-172 1..285 1..285
CiAPx02 474 1.12e-171 1..282 1..282
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12037' 'complement(join(4162..4350,4774..4876,4972..5051,5136..5218,6424..6472,6560..6625,7008..7057,7157..7281,7366..7478))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7366..7478 111 N° 2 7157..7281 123 N° 3 7008..7057 48 N° 4 6560..6625 64
N° 5 6424..6472 47 N° 6 5136..5218 81 N° 7 4972..5051 78 N° 8 4774..4876 101
N° 9 4162..4350 187  
complement(join(4162..4350,4774..4876,4972..5051,5136..5218,6424..6472,6560..662 5,7008..7057,7157..7281,7366..7478))


exon

Literature and cross-references LuAPx104(Lus10019781|PACid:23164073)
DNA ref. Phytozome 12:   scaffold1491 (7478..4162)
Protein sequence: LuAPx104(Lus10019781|PACid:23164073)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   285 (300)
PWM (Da):   %s   31374.26 (33047.8) Transmb domain:   %s   o256-278i
PI (pH):   %s   8.22 (9.30) Peptide Signal:   %s   cut: 22 range:22-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYPIVDAAYLKEVDKARRDLRALISSKNCAPIMLRLAWHDAGTYDKNTKTGGPNGSIRNDEELAHGANSGLKIALDFCEEVKAKHPKITYADLFQLAGVVAVEVTGGPTIDFLPGRKDS
KISLKEGRLPDAKKGSIHLKDVFHRMGLSDKDIVALSGAHTLGRAHSNRSGFEGPWTKEPLKFDNTYFVELLKGETEGLLKLSTDNALLDDPAFRPFVELYAKDEEAFFKDYATAHKKLS
ELGFSPASKVTQKDSTVLAQGTVGIVVTAAVMFFSYMYEVHRRSK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction. Extra 5' end.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTACCCCATCGTCGATGCCGCTTACCTCAAGGAAGTCGACAAGGCTCGCCGCGATCTCCGCGCTCTCATCTCCTCCAAGAACTGCGCTCCGATCATGCTGCGCTTGGCGTAACCG
TCCTATTGCTGTTTTCGTTTTCTCAATTTGACTTTGCTTGTTGGTTTCGTGATCTTCGCCTTTCGTAAATGTTTCAGTTTTGGCACGACGCCGGGACGTATGATAAGAACACCAAGACCG
GTGGACCTAATGGCTCTATTAGGAACGACGAGGAGCTGGCCCACGGTGCTAACAGTGGCTTGAAGATCGCTCTGGATTTCTGCG
GTGAGATTAATGTCTTCCGTTTGTTTCTCACAGTTT
TAATGTGCTCGTTTTGGAGTTATGGTTGATTGCTGAACTGAGTGTTTTTACCTTGCTCTGTAGAGAGGAAGTGAAGGCCAAGCATCCTAAAATCACTTACGCCGATTTGTTCCAGGTGAT
TGATTTTTATGAGTTTGTTTGATCATTTCTGCCGCAGACGTTCTCTCCCGGGCTGTTTGTTTGAATTGTGAGACTTGATTCTCTTGCCTTGAATATCCTAGTGTTAGATGGTAGTGAAGT
GTGAAGGATTTGGTTAGCAGTATTATCTACGCATCTGTATTGCATGATTAGAAATCTTAAGGAAAGTTTAGAAACACGACTTTCATCTACATTCCTTTGATGAATTAGTCAATGTGCTTC
TAGTTTCTTGTTCATTACTTTGACAGAACGCAGTGTTCAATTTAGATTATCATCTGATGACTGAGAGCTGACAACTGCTCTCGAATTAGAATCTATTTTTTACTGCCTACTAATTCTGTT
TGTATGCTTCATTGTAGCTCTGGCTGGTGTCGTTGCAGTTGAGGTCACTGGAGGTCCAACCATCGATTTTCTCCCTGGCAGGAAGGTATGTGACCGTTGGCTAATAGTTATACAACTACA
ATGTATTTAGCCGATTACATTTTTTGAAGTTACTGACTGAGATGTTCGTCAGGAGATTCAAAAATTTCCCTCAAGGAAGGGCGACTTCCGGATGCCAAAAAAGGTATTAACGATTCAAGA
TATTAGCTCTTGATTTACTCATGGCATCTTATAATGTGTCAAATGTCATGCGTTGCATAGTACCAGTGAATTCTATCTTCAAGCCCATTGTCAGCCATAATATTTTGTCTAGAATGTGGA
CAGATGCTTTTTTGGGGGACTGACAAACTATGGTTTCTAAGTCATACATAGCTCACTTGAATTCCTATCCTTTCACAATGTGGTCTTGCTTGTACCCGAACCTGAGATGAGTGTTTCTTG
TGAGGGTAAATGGTAACATAACAGTCTGAAGGCTTCTCGATTAATGAATATCTAGCTTTTGAGTGCATATACTAGTGACGACTGGTATAGTTTCACCAATATTTGTCACTGATCGTTAAT
TCTATGTTGATCTCCTTGAAATCCCTAGCTTTCCTCTCTCTTCGTATGAGTATGGCGGCAGTGGTTTGTGATGGTGGAAGAAAATTAGAGTTTGTTAATATTCTCAGAAATGATTTTCCT
TAATCATCGCTTAATATTTAAGTTTTTCCTTTAACATGTTGTTGGAAAGCCAGTTCATTGGAACATAGTCCACTGCACCAGTGTTCTTGTTCCTTAAATCAATCTTTCCAAGTGTTGATG
TTTCTAAGAATTTTCTTTGAAATATCCTTCAGGGTGCCAGCCGTAGGTGATGATGCTTTTGAATTTTTTTGAGGTTTCTTTCTGGCATCTTAGAATTTCCTGGGCTCTCAGATTTTTCTT
TGAATTCCTAGGAGATAGCTAGCCTCTGATAGCCTCCCAGTAACGTTTATATCCCTTAAAGAAACTAAGAAAGGGCTATATGCATTGGCCTTGTTGTCCTAAATCAGGCCACTTTTTCAC
AACTGACTATCTATTTTCTAACCTATGGAAGCATGCACGGTTAGATTCATGTTTCCAAGGCTTAGTAGCTTTCGCCTTATGTAGATTCCCAAGGGTCATCCATGAGGATTCATGCAATGT
ATTAAGGTGAAGTGCAACACTTTTTTTACGTGATCGTTGAAACGTTTCTTGTTGGTCACAACTTACCTAGTTCTTAGAGTCCCATTTGCTATCTTCATTGCAGGTTATTTGTTCTCTTAC
CTAGTTAATTCACCGTGTGGCATATCATCTTTGTTGCGAGTGACTGTCCTCCGTTTCATTATAGAATTGCTGGATTCATTCTACATAGTCTGGTTAATTTTGTGCTAGGTGTTCAATTCA
TTTGAAGGACGTATTCCATAGGATGGGTCTGTCTGATAAGGATATTGTGGCACTATCAGGAGCCCATACTCTG
GTAATTTCCTACAACTTATCTATTTCCTTTAGCAATACTAGAATAAA
CAAACCTTAACTTTCCAGTCTAAATGGTGTTTGGCAGGGGGAAGGGCACATTCAAATAGATCAGGCTTTGAAGGCCCATGGACCAAGGAACCACTGAAGTTTGACAATACATACTTCGTG
TAAGCTTCTGAATTCACAGTAGACTAGCATTGGTCACAGGAATCGTGCAAAAACCACCCGGGTCAAAATCATGTTTCCATGCTTGTTATTCCAGGGGGAACTGCTGAAGGGTGAGACTGA
GGGACTACTCAAACTCTCAACTGACAATGCCTTGTTGGATGATCCCGCTTTCCGTCCTTTCGTTGAGCTTTATGCAAAG
GTAGCGCCACAAACATTTTGTTTATCAAGTTTTCTCTCTTC
TTGCTTGATCTACGCATCCAAACTCAGTATTTTTATCCTTCGTAAATCATAATACTAGAAATGATTCTGGCCCTTCTAATCTGCCATATTAAACTGACGTCCCTAAGCTGTAGAGTATAG
ACTCGCACCGGAGATTTTTTGTTCGTGGTTTTGGACTTTTGGTCACAGGTTCCGTTTGTTCTCCATACTGAGTCTATCCAACTTCTTTTGAGTAAAACTAATACCATACCTACGTACACT
AGTAGTCTCTGGAAATCGGTACCGTCTTTTTCTTGACATGTAACTAAAAGTATATCGGAAACCAAAATAGCATCAAATTCGCGACTTGGCCGTATCGTTCTTATTTTATATGCATGATGC
TTGATTCTGCTTGTTATGACAGGAGACGAAGAAGCATTCTTCAAGGACTACGCTACCGCGCACAAGAAACTCTCGGAACTAGGCTTCTCCCCAGCCTCCAAGGTAACTCAGAAAGACAGC
ACCGTACTCGCACAGGGAACAGTTGGAATAGTGGTAACTGCGGCAGTTATGTTCTTCAGCTACATGTACGAAGTCCACAGGCGATCCAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTACCCCATCGTCGATGCCGCTTACCTCAAGGAAGTCGACAAGGCTCGCCGCGATCTCCGCGCTCTCATCTCCTCCAAGAACTGCGCTCCGATCATGCTGCGCTTGGCTTGGCAC
GACGCCGGGACGTATGATAAGAACACCAAGACCGGTGGACCTAATGGCTCTATTAGGAACGACGAGGAGCTGGCCCACGGTGCTAACAGTGGCTTGAAGATCGCTCTGGATTTCTGCG
AG
GAAGTGAAGGCCAAGCATCCTAAAATCACTTACGCCGATTTGTTCCAG
CTGGCTGGTGTCGTTGCAGTTGAGGTCACTGGAGGTCCAACCATCGATTTTCTCCCTGGCAGGAAGGATTCA
AAAATTTCCCTCAAGGAAGGGCGACTTCCGGATGCCAAAAAAG
GTTCAATTCATTTGAAGGACGTATTCCATAGGATGGGTCTGTCTGATAAGGATATTGTGGCACTATCAGGAGCCCAT
ACTCTG
GGAAGGGCACATTCAAATAGATCAGGCTTTGAAGGCCCATGGACCAAGGAACCACTGAAGTTTGACAATACATACTTCGTGGAACTGCTGAAGGGTGAGACTGAGGGACTACTC
AAACTCTCAACTGACAATGCCTTGTTGGATGATCCCGCTTTCCGTCCTTTCGTTGAGCTTTATGCAAAG
GACGAAGAAGCATTCTTCAAGGACTACGCTACCGCGCACAAGAAACTCTCG
GAACTAGGCTTCTCCCCAGCCTCCAAGGTAACTCAGAAAGACAGCACCGTACTCGCACAGGGAACAGTTGGAATAGTGGTAACTGCGGCAGTTATGTTCTTCAGCTACATGTACGAAGTC
CACAGGCGATCCAAGTAG

Retrieve as FASTA