Entry information : LuGPx140(Lus10026887|PACid:23142851)
Entry ID 12047
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx140(Lus10026887|PACid:23142851)
Name LuGPx140(Lus10026887|PACid:23142851)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx140
start..stop
S start..stop
LuGPx19 457 1.57e-164 1..235 1..235
LuGPx211 374 2.27e-133 1..245 1..242
PtGPx01 360 6.79e-128 3..244 2..232
CsGPx01 348 9.01e-123 1..245 1..246
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12047' 'join(378003..378281,378547..378623,378727..378788,379224..379342,379424..379591,379689..379718)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 378003..378281 277 N° 2 378547..378623 75 N° 3 378727..378788 60 N° 4 379224..379342 117
N° 5 379424..379591 166 N° 6 379689..379718 28  
join(378003..378281,378547..378623,378727..378788,379224..379342,379424..379591, 379689..379718)


exon

Literature and cross-references LuGPx140(Lus10026887|PACid:23142851)
DNA ref. Phytozome 12:   scaffold651 (378003..379718)
Protein sequence: LuGPx140(Lus10026887|PACid:23142851)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   244
PWM (Da):   %s   26783.73  
PI (pH):   %s   10.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSLPFAATPSSPSHKYIAERPSCYSPNQQSFRVSVASARSSPVFASSKSGFLRHGLSLQSQNSAGLVRKNPSFRVFARATTEKSIHDFTVKDIDGKNVSLSKFKGKALLIVNVASRCG
LTSSNYSELSHVYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKQFACTRFKADFPIFDKVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYAPTTSPFQIEKDIQK
LLAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTCTTTACCGTTCGCTGCAACTCCCTCCTCTCCTTCGCACAAGTACATCGCAGAAAGGCCAAGCTGTTATTCACCCAACCAGCAGTCATTCCGCGTTTCCGTCGCATCAGCA
AGGTCGTCGCCGGTGTTCGCGTCTTCAAAATCAGGGTTTCTGCGACATGGGTTGTCTTTACAATCGCAGAATTCAGCTGGGCTTGTTCGAAAGAATCCTTCTTTCCGCGTTTTTGCCAGA
GCCACCACCGAGAAATCAATCCACGACTTCACTGTAAAG
AGGTGCGGTTTTTTGAAGGCTTTGATTACGACTTACGAGTTTCTGCCTTTCCCTCTTTCATACGTGTTCTACCGATGGTTT
GTCCGAATCTACTATAAGCTTGGTTTGGTAGGTTGGATTTTTAACGTTTTCCGTCCGGACATGAAAGATAGATTCTACAACGTGATTTTGGGAGCGAACTTTCGTGTTGCTAACTAACTC
GAGAAGTATCTACTTGAATTCATTGTAGCAGAAACCAATGACTTAAGGTTCCATTTATATGTACAGGACATTGATGGTAAAAACGTGTCTCTTAGCAAATTCAAAGGCAAAGCTCTGTTG
ATTGTCAATGTTGCTTCCAGATG
TGGTACTCTCTCGCCAATCCATATATATAACTGATGAATGATGATTCATATCCAACATCCCATAGGTTTACCTTTTCAATCTATTTTGCTGTCTTTT
GATTGCAGTGGTTTGACATCTTCCAACTATTCAGAACTATCGCACGTTTATGAGAAGTACAAGACACAAGAGGTCAGTCAGATTCCTAGAGATTTCTAGATTTCTTGGCATCTAGATTTA
TCATGTTTCCTAAGAAAGTATGAACGGAGGTTAGTTGAAGAAAGTTGAGCTGAAATTTAGAGAGGTTACGGAGGAAAGTCGAATAGAGTGATATGAGAGATTCCAAGTGGAATCGTGTTT
CCCAAGCTACTTTATTGGAAATTAAACTTTCCTAGGAGTCCTTGATATTCCTTAATTTAACTTTCCTTCCACGAACAATTTCAACATCAACTCAATTTTTTCAACTATTCTCAATTCAAC
TTTCATAGAAAACATGATTCTAGATACCAAACCTTATCTAAGTTTGCAGACGGTGTTCATCGTCAATAAGTCGTTATCATTCGTGAGTGTCAAGTTCGTTATGAATACAATTATGTAAAT
CATTCAGTTGGTTTTGTAATATTGCAGGATTTGAAATCCTAGCCTTCCCTTGCAATCAGTTTGGAGGGCAAGAGCCAGGATCGAACCCGGAGATCAAGCAGTTTGCTTGTACCAGATTCA
AAGCTGATTTTCCTATATTTGACAAG
AGGTAGTTAGATAGGATGTGGCTTTCATGGTTGGATAGTATCTGTCTTAAGGAGAATTCGAAGAAGTTGTGTGGTGACTGCAGGTTGACGTGAA
TGGGCCGAGCACAGCACCAGTTTACCAGTTTCTGAAGTCAAGTGCTGGGGGATTTTTAGGTGATTTGATCAAGTGGAACTTTGAGAAGTTCTTGGTGGACAAGAATGGTAAGGTTGTGGA
ACGGTATGCCCCAACTACATCACCTTTCCAAATCGAG
AGGTACATTTCTTTCCATCTTCTCTTTTAAGAGCTTCCTGCATGACATTACAACAGATGAATGGTGTTCTATCATAGTTTATC
TGTTACTTGTTTGCAGAAGGATATTCAGAAGCTGCTTGCCGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTTCTTTACCGTTCGCTGCAACTCCCTCCTCTCCTTCGCACAAGTACATCGCAGAAAGGCCAAGCTGTTATTCACCCAACCAGCAGTCATTCCGCGTTTCCGTCGCATCAGCA
AGGTCGTCGCCGGTGTTCGCGTCTTCAAAATCAGGGTTTCTGCGACATGGGTTGTCTTTACAATCGCAGAATTCAGCTGGGCTTGTTCGAAAGAATCCTTCTTTCCGCGTTTTTGCCAGA
GCCACCACCGAGAAATCAATCCACGACTTCACTGTAAAG
GACATTGATGGTAAAAACGTGTCTCTTAGCAAATTCAAAGGCAAAGCTCTGTTGATTGTCAATGTTGCTTCCAGATGTGGT
TTGACATCTTCCAACTATTCAGAACTATCGCACGTTTATGAGAAGTACAAGACACAAG
GATTTGAAATCCTAGCCTTCCCTTGCAATCAGTTTGGAGGGCAAGAGCCAGGATCGAACCCG
GAGATCAAGCAGTTTGCTTGTACCAGATTCAAAGCTGATTTTCCTATATTTGACAAG
GTTGACGTGAATGGGCCGAGCACAGCACCAGTTTACCAGTTTCTGAAGTCAAGTGCTGGGGGA
TTTTTAGGTGATTTGATCAAGTGGAACTTTGAGAAGTTCTTGGTGGACAAGAATGGTAAGGTTGTGGAACGGTATGCCCCAACTACATCACCTTTCCAAATCGAG
AAGGATATTCAGAAG
CTGCTTGCCGCGTAA

Retrieve as FASTA