Entry information : LuGPx165(Lus10029651|PACid:23152157)
Entry ID 12049
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx165(Lus10029651|PACid:23152157)
Name LuGPx165(Lus10029651|PACid:23152157)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx165
start..stop
S start..stop
BnGPx05_other 286 1.57e-100 1..170 1..170
BrGPx05_other 284 9.6e-100 1..170 1..170
EgrGPx09 279 4e-98 1..169 1..169
VvGPx05 279 4.18e-98 1..170 1..170
Gene structure Fichier Exons


exon

Literature and cross-references LuGPx165(Lus10029651|PACid:23152157)
DNA ref. Phytozome 12:   scaffold418 (435118..437038)
Protein sequence: LuGPx165(Lus10029651|PACid:23152157)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   19404.87  
PI (pH):   %s   9.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGISGSVPEKSIHEFTVKDSRGKDVELSIYQGKVLLVVNVASKCGFTDTNYTQLTDLYQKYKDQGFEILAFPCNQFLNQEPGTSEEAQEFACTRYKAEYPIFQKVRVNGKQAAPLYKFLK
TYKNGFMGSRIKWNFTKFLISKEGQVVGRFGPTVSPLSMETHIKKELGDQE*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
CDS
Send to BLAST