Entry information : LuGPx46(Lus10008499|PACid:23177406)
Entry ID 12054
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx46(Lus10008499|PACid:23177406)
Name LuGPx46(Lus10008499|PACid:23177406)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx46
start..stop
S start..stop
LuGPx220 454 6.17e-165 1..236 1..238
PtGPx06-2 324 1.16e-113 1..236 1..238
LuGPx40 320 3.17e-113 68..236 1..169
ThasGPx06-2 315 6.25e-110 42..235 51..239
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12054' 'complement(join(125987..126019,126107..126274,126493..126611,126884..126945,127018..127094,127174..127425))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 127174..127425 250 N° 2 127018..127094 75 N° 3 126884..126945 60 N° 4 126493..126611 117
N° 5 126107..126274 166 N° 6 125987..126019 31  
complement(join(125987..126019,126107..126274,126493..126611,126884..126945,1270 18..127094,127174..127425))


exon

Literature and cross-references LuGPx46(Lus10008499|PACid:23177406)
DNA ref. Phytozome 12:   scaffold835 (127425..125987)
Protein sequence: LuGPx46(Lus10008499|PACid:23177406)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236 (302)
PWM (Da):   %s   26120.43 (34461.5)  
PI (pH):   %s   9.72 (8.38) Peptide Signal:   %s   cut: 22 range:22-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCSSIRNLSRKNLIFTASSASSLLRTGPLRSISSLGLYYSRLPRRRSVSLKQCPGLVACSARFDRAMASNSEAPQSIYDFTVKDARGNDVDLSTYKGKVLLIVNVASQCGLTNSNYTEL
TELYKKYKDQGLEILAFPCNQFGSQEPGSNEQIMEFACTRFKAEYPIFDKVDVNGNNAAPIYKFLKSSKGGLFGDGIKWNFAKFLINKEGQVVDRYAPTTSPLSFEKDVKKLLGVA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGTTCTTCAATCCGCAATCTCTCCCGTAAAAATCTCATCTTTACAGCCTCATCCGCTTCTTCTCTTCTTCGCACCGGACCTCTCCGATCGATTTCTTCTCTGGGTTTGTACTAT
TCTCGTCTTCCGCGTCGGCGATCAGTTTCCTTGAAGCAGTGCCCCGGTTTGGTTGCTTGTTCTGCCAGATTCGATCGAGCTATGGCCAGCAACTCCGAAGCTCCTCAGTCCATTTACGAC
TTCACTGTCAAG
GTATAAATAAAGTTGGGGGTTTCCTTGTATTGGATTGAAATTATTGGTTGGCTGAATTTTGGATTCTGGTTGTTTGCAGGAGACGCTAGAGGGAATGATGTTGATCTC
AGTACTTACAAGGGCAAAGTTCTTTTGATTGTCAATGTCGCCTCCCAATG
GTAAATTTCCCAACTTTATTTCACTAAGGGGTTAGTTATGTATCGAACATGAAAATTTACTGTTTGTTGC
AGTGTGGCTTGACCAATTCGAATTACACTGAGCTGACTGAGCTGTACAAGAAGTACAAAGATCAAGGTTTTCCTCTTCGCCCAGTTTCTTTGTGTTTGATTGTGATTAGTGACATAAGAG
AATATTCAATCCTTGGCTTGTGTGCATAAATGTTGTGGCTAATGGTCTTCTGAAGCAGATTATTGAGCTTATTCATTACAAGTACTGTATTCATTCTTGGCCTTCAAGTAGAAGTGTAGT
GGGAAATTATCTGTAATCTATTTGATCTCAGTCTAAGCTCAGTGGTCTACGTTTGTGATGACTAGTAACTCATTTTCCCCACTCGTTGCCTGGAGCAGGTGTCTAGAGATCTTGGCTTTC
CCTTGCAATCAGTTTGGATCTCAGGAGCCTGGCAGCAACGAGCAAATCATGGAGTTTGCTTGTACTCGCTTCAAGGCCGAGTATCCCATTTTCGACAAG
GTGAGGTTCGGAGGTCAACTA
TACAATTAAACATGATCTAGACTAGAGACTCTACAAACCAATTCTTTTAGTTGTGGTGTTATGAATTACTCAAGACATCAATTAACCTTATGAATACCGATATCCTTAAATCGACTAAAG
ACTCCACGACGATGTCCTTACCTTGTAGTAGAATTCAAATTGATGATGGTTTGTTTTTGTTTTTAACACTAATACAGGTGTTGATGTGAACGGTAACAATGCTGCTCCAATCTACAAGTT
CCTCAAGTCAAGCAAAGGTGGCCTCTTTGGGGATGGTATCAAGTGGAACTTTGCCAAGTTCCTCATCAACAAAGAGGGGCAGGTGGTTGATCGATACGCTCCTACTACCTCCCCTCTCAG
CTTCGAG
GTACATCCGAGTTATGTTTCATTTTCGATTCTCCTGATCGATGACTAACTCTGACCATGTATATATTTCCTTTGGTAAAATTTGCAGAAAAAGATGTGAAGAAACTGCTTGGG
GTTGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGTTCTTCAATCCGCAATCTCTCCCGTAAAAATCTCATCTTTACAGCCTCATCCGCTTCTTCTCTTCTTCGCACCGGACCTCTCCGATCGATTTCTTCTCTGGGTTTGTACTAT
TCTCGTCTTCCGCGTCGGCGATCAGTTTCCTTGAAGCAGTGCCCCGGTTTGGTTGCTTGTTCTGCCAGATTCGATCGAGCTATGGCCAGCAACTCCGAAGCTCCTCAGTCCATTTACGAC
TTCACTGTCAAG
GACGCTAGAGGGAATGATGTTGATCTCAGTACTTACAAGGGCAAAGTTCTTTTGATTGTCAATGTCGCCTCCCAATGTGGCTTGACCAATTCGAATTACACTGAGCTG
ACTGAGCTGTACAAGAAGTACAAAGATCAAG
GTCTAGAGATCTTGGCTTTCCCTTGCAATCAGTTTGGATCTCAGGAGCCTGGCAGCAACGAGCAAATCATGGAGTTTGCTTGTACTCGC
TTCAAGGCCGAGTATCCCATTTTCGACAAG
GTTGATGTGAACGGTAACAATGCTGCTCCAATCTACAAGTTCCTCAAGTCAAGCAAAGGTGGCCTCTTTGGGGATGGTATCAAGTGGAAC
TTTGCCAAGTTCCTCATCAACAAAGAGGGGCAGGTGGTTGATCGATACGCTCCTACTACCTCCCCTCTCAGCTTCGAG
AAAGATGTGAAGAAACTGCTTGGGGTTGCCTGA

Retrieve as FASTA