Entry information : LuGPx47(Lus10008534|PACid:23177363)
Entry ID 12055
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx47(Lus10008534|PACid:23177363)
Name LuGPx47(Lus10008534|PACid:23177363)
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx47
start..stop
S start..stop
LuGPx220 114 5.55e-34 7..69 107..169
LuGPx46 114 9.41e-34 7..69 105..167
HbGPx06 107 9.05e-32 7..69 37..99
PtGPx06-1 107 1.06e-31 7..69 37..99
Gene structure Fichier Exons


exon

Literature and cross-references LuGPx47(Lus10008534|PACid:23177363)
DNA ref. Phytozome 12:   scaffold835 (312981..312187)
Protein sequence: LuGPx47(Lus10008534|PACid:23177363)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   73
PWM (Da):   %s   8245.98  
PI (pH):   %s   6.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPPNGNFFTEGGLTNSNYTQLTELYKKYKDQGLQILAFPCNQFGSQEPGSNEQIMEFACTRFKAVPPLQLRD*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. PS.
DNA
Send to BLAST
CDS
Send to BLAST