Entry information : LuPrx101(Lus10018929|PACid:23144652)
Entry ID 12065
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang LI)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx101(Lus10018929|PACid:23144652)
Name LuPrx101(Lus10018929|PACid:23144652)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx101
start..stop
S start..stop
LuPrx154 581 0 1..325 1..322
GaPrx08 358 1e-124 5..325 6..327
GhPrx35 358 4e-124 5..325 6..327
BrPrx13-1Ab_other 350 6e-121 4..325 14..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 578053..578274 222 N° 2 578373..578546 174 N° 3 579534..579699 166 N° 4 579787..580202 416
join(578053..578274,578373..578546,579534..579699,579787..580202)


exon

Literature and cross-references LuPrx101(Lus10018929|PACid:23144652)
DNA ref. Phytozome 12:   scaffold103 (578053..580202)
Protein sequence: LuPrx101(Lus10018929|PACid:23144652)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   35270.55 (32615.2)  
PI (pH):   %s   4.82 (4.73) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCFTSNPLFLSFFLFLHSLLLAGSNGQLQFGFYDNSCPAAEQVVFNTVKQASLSEPRTAARLLRLSFHDCFVEGCDGSILLNGGEQSAFGNQGLGSFDVIETAKERLENLCPGVVSCADIVALAARDAITLSHGPTFNIPTGRRDGRVNDVNNAASLPDVKDSADVMIEKFRQKGLSVKDLVLLTAGGHTIGTTACFFVKDRLYEFRPPTTPTDPTINPELLRELERMCPKGGDVNDRVRMDWSTPDAMDDQIIRNIQQGFAVLASDARLADNGEAVDIMNSYLSTNNATAFIFDFAEAMVKMGTMAVKTGTQGEIRRKCNVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction. Extra PS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGTTTCACTTCAAACCCTCTGTTTCTCTCCTTCTTCCTCTTTCTCCACTCTCTCCTCCTGGCCGGCTCAAATGGTCAGCTCCAGTTCGGCTTCTACGACAACTCCTGCCCTGCC
GCCGAGCAAGTCGTCTTCAACACTGTCAAGCAAGCCAGCCTCTCCGAACCCCGCACTGCCGCCCGCCTCCTCCGCCTCTCCTTCCATGACTGCTTCGTCGAG
GTTCGTGACAAAAAACCC
AGAGCTTTCCTGAAGATTTCTGTTTCTGGGTTTTTTATCAGGCTCTGATGCTCTGTTTTTTTTTTTGTAAAATTGAAAAGGGTTGTGACGGCTCGATATTGCTGAACGGCGGGGAGCAGA
GTGCGTTTGGGAATCAAGGGCTGGGATCGTTTGATGTGATCGAAACGGCTAAAGAACGGCTGGAGAATCTGTGCCCTGGAGTCGTCTCTTGCGCGGACATTGTGGCTTTAGCTGCTCGTG
ACGCCATCACCTTG
GTACTCTCACACAAAGTTTTCTCCAATCCTCTGTTTTTACTGTCTCTGGTTTAGTAATCCTCTTTTTTTTTTATTCTGTGGGTAGTAACTTTTTTTTTTTACTGAA
TTTGGCCTTGTGGTAAAAGATAAGAGTTTTTGTTACGTGGAAGCTTTGTGGTAAAATGGAGAAAATAAATTTTAATGTGGGATGTTGGTGGAATTAGAATTGTTGAAGACCCTGAGTGAG
TTTTCGAATTAAGGTCTAGTTTATATAAAAATTGAACTTATAATTTTTAGTTTCAAAAATTTTGACAATATAATTTCATTGCACTATGATTCTAGGACTCTGGACGGTGGCCTAAGTTGG
CCAACCGCCAATTTCTCCATTGGGATGCTGGTTGGTTGTGTGTTGGTGGTTGACGGATATCAAAGGTGATGCTCGATGGCCAAATGAGGGACGAGTCAACGGGGGTTGTCTTTTACGATC
TTGATTTTTCGGGATGAAAAATTATAATTATATGGAAATTTTTTAAAATTCAAAATTTTATATTAGTTGAATTTTTTTATAAAAGTCAACTAATATAAAATTTCCTTCTATCTTAAAATG
TTACCTAAGATGTCCTCTAACTAGAACTATGTACCTTAAACAGTGACATGGATTGACCTACACCCTATCGATTTTAATGTCGATTGTAACGAGCTAGTTCTTTCACTCATTTCTTCTTTT
CGGGTCGGTTTTTGGTGTTCTTTGATGTACCATAATGATTAGAAATACCTAGTTCATGCTTGACGTGCTTCCATATTTGGATGTTCAAGCCGTTTGCCATTAATAAACAGAGTCCCTTGG
ATATCTCTCATCTCTCAAATACAGTGACAAAGGGTTTCGTTACTTGAATTGATGTTTAGAATATAATTTTGCGTTTGCTTGTTATCTTTTTATCTCCGTTCGAAACTATATAATTATGAT
AAATATTTACTGATGTTTCTTCTGTTATGACCGATTGACAGAGTCATGGGCCAACTTTTAACATTCCGACAGGGAGAAGAGACGGCAGAGTTAACGATGTTAACAATGCTGCCAGTTTGC
CGGACGTTAAGGATTCCGCTGATGTTATGATCGAAAAGTTCCGTCAGAAAGGATTGTCCGTTAAAGATCTCGTCCTTCTCACCGCAG
GTACGGCGACTACGACGACGTATTTAGGATTCG
AGACCGATCGAACAACATTTTCGGCTAAACTCGACTCTGTTTGTCGTATTTCAGGAGGGCACACAATTGGGACGACTGCGTGTTTCTTCGTGAAGGACCGGCTCTACGAGTTCAGACCTC
CGACGACCCCAACCGACCCGACCATCAACCCAGAGCTCCTGCGGGAGCTAGAAAGGATGTGCCCGAAAGGGGGCGACGTCAACGACCGAGTGCGTATGGACTGGTCGACACCGGACGCGA
TGGACGACCAGATTATTCGCAACATCCAACAAGGGTTCGCCGTGCTGGCATCCGACGCAAGGCTGGCCGATAACGGTGAAGCAGTCGATATTATGAATTCTTACTTGAGTACCAACAATG
CGACGGCGTTTATCTTCGACTTTGCCGAGGCCATGGTGAAAATGGGGACCATGGCGGTTAAAACGGGGACTCAGGGTGAAATCAGGAGGAAATGCAACGTGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGTTTCACTTCAAACCCTCTGTTTCTCTCCTTCTTCCTCTTTCTCCACTCTCTCCTCCTGGCCGGCTCAAATGGTCAGCTCCAGTTCGGCTTCTACGACAACTCCTGCCCTGCC
GCCGAGCAAGTCGTCTTCAACACTGTCAAGCAAGCCAGCCTCTCCGAACCCCGCACTGCCGCCCGCCTCCTCCGCCTCTCCTTCCATGACTGCTTCGTCGAG
GGTTGTGACGGCTCGATA
TTGCTGAACGGCGGGGAGCAGAGTGCGTTTGGGAATCAAGGGCTGGGATCGTTTGATGTGATCGAAACGGCTAAAGAACGGCTGGAGAATCTGTGCCCTGGAGTCGTCTCTTGCGCGGAC
ATTGTGGCTTTAGCTGCTCGTGACGCCATCACCTTG
AGTCATGGGCCAACTTTTAACATTCCGACAGGGAGAAGAGACGGCAGAGTTAACGATGTTAACAATGCTGCCAGTTTGCCGGAC
GTTAAGGATTCCGCTGATGTTATGATCGAAAAGTTCCGTCAGAAAGGATTGTCCGTTAAAGATCTCGTCCTTCTCACCGCAG
GAGGGCACACAATTGGGACGACTGCGTGTTTCTTCGTG
AAGGACCGGCTCTACGAGTTCAGACCTCCGACGACCCCAACCGACCCGACCATCAACCCAGAGCTCCTGCGGGAGCTAGAAAGGATGTGCCCGAAAGGGGGCGACGTCAACGACCGAGTG
CGTATGGACTGGTCGACACCGGACGCGATGGACGACCAGATTATTCGCAACATCCAACAAGGGTTCGCCGTGCTGGCATCCGACGCAAGGCTGGCCGATAACGGTGAAGCAGTCGATATT
ATGAATTCTTACTTGAGTACCAACAATGCGACGGCGTTTATCTTCGACTTTGCCGAGGCCATGGTGAAAATGGGGACCATGGCGGTTAAAACGGGGACTCAGGGTGAAATCAGGAGGAAA
TGCAACGTGGTTAATTAA

Retrieve as FASTA