Entry information : LuPrx110(Lus10020312|PACid:23144077)
Entry ID 12071
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx110(Lus10020312|PACid:23144077)
Name LuPrx110(Lus10020312|PACid:23144077)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx110
start..stop
S start..stop
LuPrx29 609 0 1..330 1..324
LuPrx13 457 1.37e-162 4..325 5..330
LuPrx77 454 1.43e-161 4..325 5..331
PtPrx38 403 3.14e-141 4..341 2..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12071' 'complement(join(343424..344284,344387..344602))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 344387..344602 214 N° 2 343424..344284 859  
complement(join(343424..344284,344387..344602))


exon

Literature and cross-references LuPrx110(Lus10020312|PACid:23144077)
DNA ref. Phytozome 12:   scaffold641 (344602..343424)
Protein sequence: LuPrx110(Lus10020312|PACid:23144077)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (332)
PWM (Da):   %s   37771.39 (35051.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   10.31 (10.34) Peptide Signal:   %s   cut: 27 range:27-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLAKTSILVVFFLLCNVFGLVPSVAGLQVGFYRSTCPQAETIVRN
LVQKRFGTDKSIAAALLRMHFHDCFVR
GCDASILIDSTPQKQSEKSAGPNQSVRGFDLIDSIKSALESACPSRVSCADIVALATRDAVALAGGPTYQLPTGRLDGLISNAGNVNLPGPTVPVTQAFNQFFRPLGFTLTEMVTLLGAH
TVGVAHCTFFQDRISNFRGTGRPDPAMDPTLAASLRQTCAGSNNPTAFLDQNTSFVVDNSFYREIGLKKGVMLIDQAIATDRSTSGIVSGLARSEAGFRQAGFRQWFAAAMVKMGNLGGS
GGGEIRKSCRVFNPKTGGSGGRPSVPPPKNGGKKNGSKKSQPGKKG*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction. Stop is missing. Extra 3' end.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGCCAAAACATCCATACTTGTGGTGTTCTTCCTTCTATGTAATGTATTCGGTTTGGTTCCCTCGGTGGCCGGTTTACAAGTTGGGTTTTACCGGTCTACTTGCCCACAGGCTGAA
ACCATCGTGCGGAATTTGGTTCAGAAGCGGTTCGGTACCGACAAGTCCATCGCCGCCGCTCTCCTTCGCATGCACTTCCACGACTGTTTCGTCAGG
GTAAGACTGTAATTTCCTTTTCTT
CATAATACTGTACAAATTAAAGTCGATGAATCAGTACATATGATAGTATTTTACTAATTTTATTTTTATCATATTAAGGGGGTTGCGACGCGTCGATCCTAATCGACTCGACTCCTCAAA
AGCAATCCGAGAAGTCAGCCGGCCCGAACCAATCGGTAAGAGGATTCGACCTAATCGATTCGATCAAATCAGCGCTCGAATCCGCATGCCCTTCCAGAGTCTCCTGCGCGGACATCGTCG
CTCTAGCCACCCGAGATGCAGTTGCCCTAGCCGGAGGCCCCACGTACCAACTCCCTACGGGACGGCTCGATGGCCTAATCTCGAACGCGGGCAATGTCAACCTCCCTGGTCCAACCGTAC
CGGTTACTCAAGCATTCAACCAGTTCTTCCGACCCTTGGGCTTCACCCTAACAGAAATGGTCACCCTTTTAGGGGCCCATACGGTTGGTGTGGCCCACTGCACTTTCTTCCAGGACAGGA
TCTCTAACTTCCGGGGAACGGGTCGTCCCGACCCGGCGATGGACCCGACCTTGGCCGCCAGCCTCCGCCAGACTTGCGCCGGGAGCAACAATCCGACAGCGTTTTTGGACCAGAACACGT
CGTTTGTTGTTGATAATTCGTTCTACAGGGAGATTGGTTTGAAGAAGGGTGTGATGCTGATTGATCAGGCGATTGCTACCGACCGGTCGACGTCGGGGATTGTGTCCGGTTTGGCGAGGA
GCGAGGCGGGTTTCCGGCAGGCGGGTTTCCGGCAGTGGTTTGCAGCGGCGATGGTGAAGATGGGGAATCTAGGTGGGAGTGGCGGAGGAGAAATCAGGAAGAGCTGTCGGGTTTTCAATC
CGAAGACGGGCGGCAGTGGTGGACGTCCGTCGGTTCCGCCGCCGAAGAACGGCGGGAAGAAGAATGGAAGCAAGAAAAGTCAACCCGGGAAGAAGGGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGCCAAAACATCCATACTTGTGGTGTTCTTCCTTCTATGTAATGTATTCGGTTTGGTTCCCTCGGTGGCCGGTTTACAAGTTGGGTTTTACCGGTCTACTTGCCCACAGGCTGAA
ACCATCGTGCGGAATTTGGTTCAGAAGCGGTTCGGTACCGACAAGTCCATCGCCGCCGCTCTCCTTCGCATGCACTTCCACGACTGTTTCGTCAGG
GGTTGCGACGCGTCGATCCTAATC
GACTCGACTCCTCAAAAGCAATCCGAGAAGTCAGCCGGCCCGAACCAATCGGTAAGAGGATTCGACCTAATCGATTCGATCAAATCAGCGCTCGAATCCGCATGCCCTTCCAGAGTCTCC
TGCGCGGACATCGTCGCTCTAGCCACCCGAGATGCAGTTGCCCTAGCCGGAGGCCCCACGTACCAACTCCCTACGGGACGGCTCGATGGCCTAATCTCGAACGCGGGCAATGTCAACCTC
CCTGGTCCAACCGTACCGGTTACTCAAGCATTCAACCAGTTCTTCCGACCCTTGGGCTTCACCCTAACAGAAATGGTCACCCTTTTAGGGGCCCATACGGTTGGTGTGGCCCACTGCACT
TTCTTCCAGGACAGGATCTCTAACTTCCGGGGAACGGGTCGTCCCGACCCGGCGATGGACCCGACCTTGGCCGCCAGCCTCCGCCAGACTTGCGCCGGGAGCAACAATCCGACAGCGTTT
TTGGACCAGAACACGTCGTTTGTTGTTGATAATTCGTTCTACAGGGAGATTGGTTTGAAGAAGGGTGTGATGCTGATTGATCAGGCGATTGCTACCGACCGGTCGACGTCGGGGATTGTG
TCCGGTTTGGCGAGGAGCGAGGCGGGTTTCCGGCAGGCGGGTTTCCGGCAGTGGTTTGCAGCGGCGATGGTGAAGATGGGGAATCTAGGTGGGAGTGGCGGAGGAGAAATCAGGAAGAGC
TGTCGGGTTTTCAATCCGAAGACGGGCGGCAGTGGTGGACGTCCGTCGGTTCCGCCGCCGAAGAACGGCGGGAAGAAGAATGGAAGCAAGAAAAGTCAACCCGGGAAGAAGGGTTAA

Retrieve as FASTA