Entry information : LuPrx111(Lus10020421|PACid:23139568)
Entry ID 12072
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx111(Lus10020421|PACid:23139568)
Name LuPrx111(Lus10020421|PACid:23139568)
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx111
start..stop
S start..stop
LuPrx35 434 8e-157 1..254 1..245
LuPrx36 431 2e-154 38..254 107..323
LuPrx36 64 0.000000000004 7..41 1..34
LuPrx37 420 6e-150 38..254 107..324
LuPrx37 68 0.0000000000001 7..41 1..34
RcPrx54 330 2e-114 17..254 91..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 68303..68417 115 N° 2 68158..68222 65 N° 3 67907..68069 163 N° 4 67373..67794 422
complement(join(67373..67794,67907..68069,68158..68222,68303..68417))


exon

Literature and cross-references LuPrx111(Lus10020421|PACid:23139568)
DNA ref. Phytozome 12:   scaffold44 (68417..67373)
Protein sequence: LuPrx111(Lus10020421|PACid:23139568)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   254 (227)
PWM (Da):   %s   27064.74 (24018.1) Transmb domain:   %s   o4-21i
PI (pH):   %s   9.98 (9.80) Peptide Signal:   %s   cut: 28 range:28-254
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKIVGISTLFVFWLVMVLANRSAVDAQGTRVGFYSTSSCPGVVSCADILALAARDSVAVTNGPRWTVPTGRRDGRVSLASDTTNLPAFNDSAAVQISKYNQKGLNTQDLVALSGAHTIGTAACAVFRYRLYNFPGSTSGADPTLDPAFVPQLRAVCPQNGNAARRVAMDTGSPNRFDNSYYANLRSGRTVLESDSVLWTDAGTRVMAQRFLGIRGLAGLTFAVEFARSMVRMGNIEIKSGAQGEIRRVCSAVN*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAAATAGTCGGGATTTCGACGTTGTTTGTGTTTTGGCTTGTGATGGTTTTAGCCAACAGGTCCGCCGTTGATGCCCAAGGGACCAGGGTAGGCTTCTATTCCACCTCATGTCCA
AGAGCCGAGTCGATTGTTCGAGCAACGGTCCAGTCACATTTCAATTCTGACCCCACCATTGCCCCTGGGATACAGCTTGCCCTGGTGTCGTTTCTTGTGCCGACATTCTCGCTCTTGCTG
CCCGCGACTCTGTTGCCGTG
GTAAGTAATTAGGTTGCTTTTCTTCGAATTATAAATCATTACTGTAATTTAGTAAAAGATTTTGAGGTTGATTTTGCGATGTGTGCAGACAAATGGGCCA
AGATGGACGGTGCCGACAGGGAGGAGAGACGGGAGGGTATCACTGGCATCGGACACAACAAACTTGCCGGCGTTTAATGACTCGGCCGCAGTTCAAATTAGCAAATACAATCAGAAAGGA
CTTAACACTCAGGATCTTGTTGCCCTCTCTG
GTACGTGTTAATTAGCTGGACAATTAATAGAATTGATGAAAGAAGAAGTAATCTAATTCATCATTAGCTCATTATGAATCACCTATCTG
ACTGATTATGGTTGACTAAACAGGGGCCCACACAATAGGGACAGCTGCCTGCGCGGTGTTCCGATACAGGCTGTACAACTTTCCGGGCTCTACCTCTGGTGCTGACCCGACGCTCGACCC
GGCGTTTGTTCCTCAACTGAGGGCTGTCTGCCCACAGAACGGAAATGCGGCAAGGAGGGTGGCCATGGACACTGGAAGCCCTAACCGATTCGACAATTCATACTACGCTAATTTGAGGAG
CGGCCGGACTGTTTTGGAATCGGACTCTGTTCTGTGGACGGATGCCGGGACCAGAGTGATGGCACAGAGGTTCCTCGGGATCAGAGGATTGGCCGGCTTGACTTTCGCAGTGGAGTTCGC
CAGATCAATGGTGAGGATGGGCAACATCGAAATCAAGAGCGGCGCTCAGGGAGAGATCCGACGTGTCTGCTCCGCCGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAAATAGTCGGGATTTCGACGTTGTTTGTGTTTTGGCTTGTGATGGTTTTAGCCAACAGGTCCGCCGTTGATGCCCAAGGGACCAGGGTAGGCTTCTATTCCACCTCATCTTGC
CCTGGTGTCGTTTCTTGTGCCGACATTCTCGCTCTTGCTGCCCGCGACTCTGTTGCCGTG
ACAAATGGGCCAAGATGGACGGTGCCGACAGGGAGGAGAGACGGGAGGGTATCACTGGCA
TCGGACACAACAAACTTGCCGGCGTTTAATGACTCGGCCGCAGTTCAAATTAGCAAATACAATCAGAAAGGACTTAACACTCAGGATCTTGTTGCCCTCTCTG
GGGCCCACACAATAGGG
ACAGCTGCCTGCGCGGTGTTCCGATACAGGCTGTACAACTTTCCGGGCTCTACCTCTGGTGCTGACCCGACGCTCGACCCGGCGTTTGTTCCTCAACTGAGGGCTGTCTGCCCACAGAAC
GGAAATGCGGCAAGGAGGGTGGCCATGGACACTGGAAGCCCTAACCGATTCGACAATTCATACTACGCTAATTTGAGGAGCGGCCGGACTGTTTTGGAATCGGACTCTGTTCTGTGGACG
GATGCCGGGACCAGAGTGATGGCACAGAGGTTCCTCGGGATCAGAGGATTGGCCGGCTTGACTTTCGCAGTGGAGTTCGCCAGATCAATGGTGAGGATGGGCAACATCGAAATCAAGAGC
GGCGCTCAGGGAGAGATCCGACGTGTCTGCTCCGCCGTCAACTGA

Retrieve as FASTA