Entry information : LuPrx123(Lus10022962|PACid:23146177)
Entry ID 12079
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx123(Lus10022962|PACid:23146177)
Name LuPrx123(Lus10022962|PACid:23146177)
Class Class III peroxidase     [Orthogroup: Prx032]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx123
start..stop
S start..stop
LuPrx25 448 6.46e-161 1..231 124..354
PtPrx37 337 1.42e-117 1..221 119..336
LuPrx136 329 5.5e-114 1..223 124..348
RcPrx14 321 5e-111 1..223 120..339
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12079' 'join(400272..400506,400609..401066)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 400272..400506 233 N° 2 400609..401066 456  
join(400272..400506,400609..401066)


exon

Literature and cross-references LuPrx123(Lus10022962|PACid:23146177)
DNA ref. Phytozome 12:   scaffold355 (400272..401066)
Protein sequence: LuPrx123(Lus10022962|PACid:23146177)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   230 (343)
PWM (Da):   %s   25328.75 (35801.7)  
PI (pH):   %s   9.11 (4.30) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEIRCPGVVSCADILNLATRDAVHLAGGPSYPVLTGRKDGLISTASNVDLPSPSISANAALAYFQSRGLDVLDMATLLGAHSIGTTDCRYIVDRLYNFKNTKKADPSMNKQLADQLRKKC
PPLSNTYTTNSSRVFLNPDSADTYQLSNSYYKRALSYQSVLGVDQQLLYTNDTLQITQEFSRADGFENWRRSVALSMARMGNINVLTGNAGEIRRNCRYTNSKLSHLIST*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATAAGGTGCCCAGGCGTTGTCTCATGTGCAGACATCCTCAACCTTGCAACTAGAGATGCAGTTCACTTGGCAGGAGGTCCATCATATCCAGTCTTGACTGGTAGAAAGGACGGC
TTGATATCAACCGCGTCAAACGTCGATCTCCCATCACCTTCTATCTCCGCCAATGCTGCATTAGCCTACTTCCAATCTAGGGGATTGGATGTTCTAGACATGGCCACTCTTTTAG
AGGTA
GGTATTCACACAACAACAACCACCTTCATCAAATTCACATATCCATCACACCAATTTTCTATATTTCAACAAGCTTTTATTATTAATTAATTAATGCAGGTGCCCATTCCATTGGTACGA
CCGACTGTCGCTACATCGTCGATCGGCTTTACAACTTCAAAAACACAAAGAAGGCAGACCCCAGCATGAACAAACAATTGGCTGACCAACTCAGGAAGAAATGCCCTCCTCTATCAAACA
CTTACACCACCAACTCCTCGAGGGTTTTTTTGAACCCAGATTCTGCAGATACCTACCAGCTCAGCAACTCCTACTATAAGAGGGCCTTGTCTTACCAATCCGTTCTAGGTGTCGACCAGC
AGCTACTCTACACTAATGACACCCTACAAATCACCCAAGAATTTTCCCGGGCTGACGGCTTTGAAAACTGGAGAAGATCTGTCGCCCTCTCCATGGCTAGAATGGGCAACATCAATGTCT
TAACAGGGAATGCAGGGGAGATACGTAGGAATTGCAGATACACCAACAGTAAACTAAGTCATCTCATCTCAACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATAAGGTGCCCAGGCGTTGTCTCATGTGCAGACATCCTCAACCTTGCAACTAGAGATGCAGTTCACTTGGCAGGAGGTCCATCATATCCAGTCTTGACTGGTAGAAAGGACGGC
TTGATATCAACCGCGTCAAACGTCGATCTCCCATCACCTTCTATCTCCGCCAATGCTGCATTAGCCTACTTCCAATCTAGGGGATTGGATGTTCTAGACATGGCCACTCTTTTAG
GTGCC
CATTCCATTGGTACGACCGACTGTCGCTACATCGTCGATCGGCTTTACAACTTCAAAAACACAAAGAAGGCAGACCCCAGCATGAACAAACAATTGGCTGACCAACTCAGGAAGAAATGC
CCTCCTCTATCAAACACTTACACCACCAACTCCTCGAGGGTTTTTTTGAACCCAGATTCTGCAGATACCTACCAGCTCAGCAACTCCTACTATAAGAGGGCCTTGTCTTACCAATCCGTT
CTAGGTGTCGACCAGCAGCTACTCTACACTAATGACACCCTACAAATCACCCAAGAATTTTCCCGGGCTGACGGCTTTGAAAACTGGAGAAGATCTGTCGCCCTCTCCATGGCTAGAATG
GGCAACATCAATGTCTTAACAGGGAATGCAGGGGAGATACGTAGGAATTGCAGATACACCAACAGTAAACTAAGTCATCTCATCTCAACATGA

Retrieve as FASTA