Entry information : LuPrx136(Lus10025586|PACid:23144996)
Entry ID 12087
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx136(Lus10025586|PACid:23144996)
Name LuPrx136(Lus10025586|PACid:23144996)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx136
start..stop
S start..stop
LuPrx25 502 2e-180 22..348 26..346
PtPrx37 471 2e-168 1..346 1..336
JcPrx01 463 2e-165 17..348 8..334
MePrx124 447 9e-159 10..348 14..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 520065..520328 264 N° 2 519672..519851 180 N° 3 519171..519330 160 N° 4 517899..518344 446
complement(join(517899..518344,519171..519330,519672..519851,520065..520328))


exon

Literature and cross-references LuPrx136(Lus10025586|PACid:23144996)
DNA ref. Phytozome 12:   scaffold145 (520328..517899)
Protein sequence: LuPrx136(Lus10025586|PACid:23144996)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (325)
PWM (Da):   %s   38459.53 (35787.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.6 (9.60) Peptide Signal:   %s   cut: 25 range:25-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIRMSSLLWVVVAAVVMMVAVEEGGGGMVEGAIGLQPPVKLKWHYYRLNTSCKYAEEYVKHQVKIYWNKDKSITAKLLRLLYSDCFVTGCDASILLDGPKSEKTAPQNARLDGFELIDRIKKVVEALCPGVVSCADILNLATRDAAHLAGWPSYPVFTGRRDGMTSSASSVDLPSASISNKAALAYFKSRGLDVLDMATLLGAHSIGKTNCVNVADRLYNFNKTGKPDPTMNKQFADQLQKACPKTNNSSPTSNWVYLNPDASAPQYQLSNSYYKRVLAYKSALGVDQQLLYSSDTKQITGEYANDKKNGTENWRRSLTLSMSRMGNINVLTGSAGEIRRNCRYTNKKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATAAGGATGTCGTCGTTGTTATGGGTGGTGGTGGCGGCGGTGGTGATGATGGTGGCGGTGGAAGAAGGCGGTGGGGGGATGGTGGAGGGGGCGATAGGGCTGCAGCCGCCGGTGAAG
TTGAAGTGGCATTACTACCGCCTGAACACGAGCTGCAAGTACGCGGAGGAGTACGTGAAGCACCAGGTCAAGATTTATTGGAACAAAGACAAATCCATCACTGCCAAGCTCCTCCGCTTG
CTCTACTCCGATTGCTTCGTCACC
GTCAGTAACACTATCTCTCTTCATCATCATATCATTCTTTTATTATTATTAATTATCAAATTTACAGTATATAATATATACTGCAATGTGTGACGT
GTGTCTAGATTTCAAATGGAGAGACCTCTTAGTGTATTTGATCAATAATTATGTTTATTGAGAAAGGAGTTTAAATTAATTTGTATGTTATTAATTAACATGATGGACACTGTACAGGGT
TGTGATGCGTCGATATTGCTGGACGGGCCGAAATCGGAGAAAACAGCTCCGCAGAACGCAAGGCTTGACGGGTTCGAGCTCATCGACCGAATCAAGAAAGTGGTGGAGGCCCTTTGTCCG
GGTGTCGTCTCATGTGCCGACATCCTCAACCTCGCCACCAGAGACGCTGCTCACTTG
GTATGAATATTCGTTCGGTTTGAAACCACATTAAAAGAGAGTAAAATGCATTAGATACCAGTT
ATATTTTGCTCGGTGCATACTATCATTAACGTTACGCTTATTTAAAACATTCCGTGTCACTTATGTTTATCTTGAATAACATCGGTCTACTATCTCTAATAAGCAAGGATGCACGAATAA
TTGATTAGTGCTATTAAAAATAAACATAAGTGACAATCGGTGTTCGAGAAAAAGATCAATGATTAGTATGTACCGTACAGCAAAATACAAGTGGTATCCCGTACAACATATTTCGAAAAA
TTAATCAGCTTTTCGATTTTGTTTCGGTTATTTGACAGGCGGGATGGCCGTCGTACCCAGTATTCACCGGAAGAAGGGATGGGATGACATCATCCGCGTCGTCGGTGGATCTGCCGTCGG
CGTCGATCTCCAACAAAGCTGCTTTGGCTTACTTCAAGTCTAGAGGCCTGGATGTTCTTGACATGGCAACCCTTTTAG
GTACATTACTCTTTTTCATGTTCTTGACATGTTCTTCACTTA
GCTTTGGTGTTATCCCTTTCATCCTTTTCACTATCGTTGTCCAATTAATCTTAAGCATTACCAAACTTCATCTTCACTATCCGAAGATAGAAACACATAGAGTCACTCTTATTAATTACT
AGAAATAGCTCGCGCTCTCTGTCGCCGAAAACAATATGGTTCTAGTGCATGTGAAAATATAAAAACGAGTCCAACCAAATAATTAAGATATACATATACAAAATTTAAAAACATATGTAA
GTACTGAAAATTGAATATGGATATTATTGGCTTGCTACTATTCATTAGCAAATATAATTGTAAGATGAGTGGCTAATTAAAACTTGGAAGTATAAATACTAAATTTACTAATGTATGTTA
TATTTTTGTTAGAAATTAAATTATATTTTAAATTGGAGAGAAAATGAATGTATAGAGTCATAAAAATGTTTAATTTATAAAATAATTATAAGCCTTATATAAGATTGATTGGAGGGGATT
TCGCGTTTTTTATGCATCAGTAAATTTCATTCTAATGCATAAAATCAGTAAAATGAGATTTACTGATTTTTTTAGTCATAATTTACCACTTGATGTTCATCATATCTTTTTTAATGATTC
TATTTTATTTTTACATTTGTTATATGATATTTTCGGGATAAATGATTTTATTCTACGGTAAGATAATTAGACTTTTTCCTTGGACTAATATGCTACATTGCTATGAACTTTATGCATACT
TTACTTAATGGTTGGAATATTTTTGTTGACGCTTCTCTGGCATATGGACTACGTTATGGTGCAGGAGCACACTCAATCGGAAAGACTAACTGCGTCAACGTAGCGGACAGGCTCTACAAC
TTCAACAAAACAGGGAAACCAGATCCAACCATGAACAAACAATTCGCCGATCAATTACAAAAGGCATGCCCTAAGACCAACAACTCTTCACCCACCAGCAACTGGGTTTATCTAAACCCA
GATGCATCAGCACCCCAATATCAGCTGTCAAATTCTTACTACAAGAGGGTTTTGGCTTACAAATCCGCGCTGGGAGTTGACCAGCAGTTGCTCTACAGCAGCGACACCAAACAGATCACC
GGCGAGTACGCCAACGACAAAAAGAACGGGACTGAAAACTGGAGGAGATCGCTTACTCTGTCCATGAGCCGTATGGGGAACATTAACGTGTTGACTGGTTCTGCTGGCGAGATTCGTAGG
AATTGCCGCTACACCAACAAAAAAGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATAAGGATGTCGTCGTTGTTATGGGTGGTGGTGGCGGCGGTGGTGATGATGGTGGCGGTGGAAGAAGGCGGTGGGGGGATGGTGGAGGGGGCGATAGGGCTGCAGCCGCCGGTGAAG
TTGAAGTGGCATTACTACCGCCTGAACACGAGCTGCAAGTACGCGGAGGAGTACGTGAAGCACCAGGTCAAGATTTATTGGAACAAAGACAAATCCATCACTGCCAAGCTCCTCCGCTTG
CTCTACTCCGATTGCTTCGTCACC
GGTTGTGATGCGTCGATATTGCTGGACGGGCCGAAATCGGAGAAAACAGCTCCGCAGAACGCAAGGCTTGACGGGTTCGAGCTCATCGACCGAATC
AAGAAAGTGGTGGAGGCCCTTTGTCCGGGTGTCGTCTCATGTGCCGACATCCTCAACCTCGCCACCAGAGACGCTGCTCACTTG
GCGGGATGGCCGTCGTACCCAGTATTCACCGGAAGA
AGGGATGGGATGACATCATCCGCGTCGTCGGTGGATCTGCCGTCGGCGTCGATCTCCAACAAAGCTGCTTTGGCTTACTTCAAGTCTAGAGGCCTGGATGTTCTTGACATGGCAACCCTT
TTAG
GAGCACACTCAATCGGAAAGACTAACTGCGTCAACGTAGCGGACAGGCTCTACAACTTCAACAAAACAGGGAAACCAGATCCAACCATGAACAAACAATTCGCCGATCAATTACAA
AAGGCATGCCCTAAGACCAACAACTCTTCACCCACCAGCAACTGGGTTTATCTAAACCCAGATGCATCAGCACCCCAATATCAGCTGTCAAATTCTTACTACAAGAGGGTTTTGGCTTAC
AAATCCGCGCTGGGAGTTGACCAGCAGTTGCTCTACAGCAGCGACACCAAACAGATCACCGGCGAGTACGCCAACGACAAAAAGAACGGGACTGAAAACTGGAGGAGATCGCTTACTCTG
TCCATGAGCCGTATGGGGAACATTAACGTGTTGACTGGTTCTGCTGGCGAGATTCGTAGGAATTGCCGCTACACCAACAAAAAAGCCTAG

Retrieve as FASTA