Entry information : LuPrx139(Lus10026748|PACid:23176570)
Entry ID 12089
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx139(Lus10026748|PACid:23176570)
Name LuPrx139(Lus10026748|PACid:23176570)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx139
start..stop
S start..stop
LuPrx222 650 0 6..334 1..330
MePrx135 450 2e-160 6..333 4..328
PpePrx79 445 3e-158 15..333 14..332
PtPrx97 444 3e-158 28..333 7..309
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 346355..346582 228 N° 2 346682..346864 183 N° 3 346968..347133 166 N° 4 347752..348179 428
join(346355..346582,346682..346864,346968..347133,347752..348179)


exon

Literature and cross-references LuPrx139(Lus10026748|PACid:23176570)
DNA ref. Phytozome 12:   scaffold361 (346355..348179)
Protein sequence: LuPrx139(Lus10026748|PACid:23176570)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (305)
PWM (Da):   %s   35559.81 (32467.3)  
PI (pH):   %s   5.71 (6.12) Peptide Signal:   %s   cut: 30 range:30-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNQSPSSSSPSLTILLLLMTSSMVTNVESQLRVDYYASTCPKLAQIVRREVMNAIKAETRMAASLLRLHFHDCFVNGCDGSLLLDGSDSEKLARPNLNSARGFEVVDSIKTAVESQCSGVVSCADILALASRDSVLLSGGPSWKVPLGRKDGLVANQTAANGLPGPFDNLTLIITKFSAVGLDDLADVISLSGGHTIGQAKCATFSNRLVNFSQTGSPDPTMESNLVAELQTLCPVNGDGNVTTAFDKGSTDLFDNHYFQNLVNNKGILTSDQVLFSGNEAATAAARNLVQIYSVNQFRFMGDFVKSMIRMGNIGPITGSDGEIRKNCRVVNSG*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCAGAGTCCTAGTAGTTCATCACCATCATTGACCATACTATTGTTGCTAATGACCTCGAGCATGGTTACGAATGTCGAATCCCAACTCAGAGTCGATTACTATGCATCAACATGC
CCGAAACTCGCCCAGATCGTGCGTAGGGAAGTGATGAATGCAATCAAGGCCGAAACACGGATGGCAGCCTCCTTGCTCCGCCTTCATTTCCACGATTGCTTTGTCAAC
GTATGTATGATT
TCATGTTCGTTGTTGGTGTTTTTTTCGATCTGATTATCGGTGTTAGGGGATGAATATATATCATGGTAGTTGTTGTGTCGTTTGCAGGGATGTGACGGTTCTCTTTTGTTGGATGGGAGT
GACAGTGAGAAGTTAGCGAGGCCTAACTTGAACTCGGCCAGGGGGTTCGAAGTTGTGGACTCGATCAAAACGGCAGTGGAAAGCCAGTGCAGTGGTGTCGTATCTTGTGCTGACATTCTT
GCCTTGGCTTCCCGCGATTCCGTGCTCTTG
GTATAGTAACTAACTAGATCAACAAACCTATTATTGACTTTGTTTGTTTCTTCAACTTGTTGGGCTTTGCTAAGATATCCAAAAATCCTA
ATTCAACGTGCAGAGTGGAGGCCCGTCGTGGAAAGTGCCGCTAGGGAGAAAAGATGGGCTTGTGGCTAATCAGACTGCTGCTAATGGGCTACCAGGCCCATTTGATAACCTAACTCTCAT
CATAACCAAGTTTTCAGCAGTTGGCCTTGATGATCTCGCCGATGTCATCTCCTTATCAG
GTAATCTATGTACTAGTCTTTTTTTTTATTACAAATCCACTACTACTATGTACAAGTCTTT
TTCAAATTTTGGTATAGCCTCACGGTTATTCATTCGAGCTGCCGGTTAGACAAATGATCGAATCATGTTCACCAAACCGTCTCTTATGATTAAAATGTTACTCTTTCAAAATTTTGTTGA
ACAGTCTATAGATTAGTGATTCGTTTTGTCGGCTAAACAAATTAACGGATCATGTCCACCAAACCGTCTCTTATGATTAAAAAAACACTATTATATGAATTCTTTTTGAATTTTGACTGA
GCCTCCTGGTTATCTATTTGAGCTATTGGTTAGACAAATGATCGAACCATGTCCACCAATGACCAAACCGTCTCTTATTATTAAAACTTTACTCATTTTTTGAATTTTGATTGAGCGTCC
TAATTATCTATTCGAGCAATCAGCTAGACAAATGATTGAACCATATCCATCTTTTATAATTAAAAATCTACTATTATATATTACCTTCTTCGGAATTTTGTACGAGCCTCCTGCTTATCC
ATTCGAGTTGTTGGTTAGGCAAATGGTTGAGCCATGAATTAACCGAAAAATAACAAAGCAAAACTGGGATCCTACAGGTGGGCACACAATTGGACAGGCAAAATGTGCCACATTCAGCAA
CAGACTTGTCAACTTCAGTCAAACCGGGTCCCCGGATCCGACAATGGAGTCCAACTTAGTCGCCGAACTCCAAACATTGTGCCCGGTGAACGGCGACGGCAACGTCACGACTGCTTTCGA
CAAGGGCTCCACTGACTTATTCGACAACCACTACTTCCAGAACCTCGTCAACAACAAAGGGATTCTGACCTCCGACCAGGTGTTGTTCTCCGGCAACGAGGCCGCCACCGCAGCCGCCAG
GAACCTCGTCCAGATCTACAGCGTCAATCAGTTTAGATTCATGGGCGACTTTGTCAAGTCGATGATTCGGATGGGGAACATTGGTCCGATTACTGGGTCTGATGGTGAGATCAGGAAGAA
TTGTAGGGTAGTTAATTCAGGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCAGAGTCCTAGTAGTTCATCACCATCATTGACCATACTATTGTTGCTAATGACCTCGAGCATGGTTACGAATGTCGAATCCCAACTCAGAGTCGATTACTATGCATCAACATGC
CCGAAACTCGCCCAGATCGTGCGTAGGGAAGTGATGAATGCAATCAAGGCCGAAACACGGATGGCAGCCTCCTTGCTCCGCCTTCATTTCCACGATTGCTTTGTCAAC
GGATGTGACGGT
TCTCTTTTGTTGGATGGGAGTGACAGTGAGAAGTTAGCGAGGCCTAACTTGAACTCGGCCAGGGGGTTCGAAGTTGTGGACTCGATCAAAACGGCAGTGGAAAGCCAGTGCAGTGGTGTC
GTATCTTGTGCTGACATTCTTGCCTTGGCTTCCCGCGATTCCGTGCTCTTG
AGTGGAGGCCCGTCGTGGAAAGTGCCGCTAGGGAGAAAAGATGGGCTTGTGGCTAATCAGACTGCTGCT
AATGGGCTACCAGGCCCATTTGATAACCTAACTCTCATCATAACCAAGTTTTCAGCAGTTGGCCTTGATGATCTCGCCGATGTCATCTCCTTATCAG
GTGGGCACACAATTGGACAGGCA
AAATGTGCCACATTCAGCAACAGACTTGTCAACTTCAGTCAAACCGGGTCCCCGGATCCGACAATGGAGTCCAACTTAGTCGCCGAACTCCAAACATTGTGCCCGGTGAACGGCGACGGC
AACGTCACGACTGCTTTCGACAAGGGCTCCACTGACTTATTCGACAACCACTACTTCCAGAACCTCGTCAACAACAAAGGGATTCTGACCTCCGACCAGGTGTTGTTCTCCGGCAACGAG
GCCGCCACCGCAGCCGCCAGGAACCTCGTCCAGATCTACAGCGTCAATCAGTTTAGATTCATGGGCGACTTTGTCAAGTCGATGATTCGGATGGGGAACATTGGTCCGATTACTGGGTCT
GATGGTGAGATCAGGAAGAATTGTAGGGTAGTTAATTCAGGTTGA

Retrieve as FASTA