Entry information : LuPrx148(Lus10027983|PACid:23181178)
Entry ID 12095
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx148(Lus10027983|PACid:23181178)
Name LuPrx148(Lus10027983|PACid:23181178)
Class Class III peroxidase    [Orthogroup: Prx121]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx148
start..stop
S start..stop
LuPrx45 664 0 6..360 1..355
LuPrx149 506 0 9..361 5..354
LuPrx01 498 2e-178 1..361 1..359
LuPrx151 489 5e-175 11..361 9..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 176058..176291 234 N° 2 176967..177158 192 N° 3 177218..177389 172 N° 4 177469..177956 488
join(176058..176291,176967..177158,177218..177389,177469..177956)


exon

Literature and cross-references LuPrx148(Lus10027983|PACid:23181178)
DNA ref. Phytozome 12:   scaffold132 (176058..177956)
Protein sequence: LuPrx148(Lus10027983|PACid:23181178)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (331)
PWM (Da):   %s   38794.4 (35494.5)  
PI (pH):   %s   4.88 (4.67) Peptide Signal:   %s   cut: 31 range:31-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLIMPAKFLVPSLLALLMLVSAGRRSYAQQLTPTYYDSTCPAVINIVRRVLENAAVADTRICASLIRLHFHDCFVSGCDASLLLDNSPTILSEKEAVGNNNSCRGYEVIDQMKTQIEAACPGVVSCADILAIAAEESVVLAGGPSWAVPLGRLDSLTANQRSLVTSSLPHMNYTVDELKANFAAVGLDTTVDLVALSGAHTFGRVQCKGFMSRIYNFNNTGAPDPTLNATLRNSLRQLCPEDRTDIVFTDLDKTTPNAFDSAYFRNLQTGEGIIWSDQVLFSTPRSDTVDIVNRFAANETAFFESFVDSMIRMGNIAPPAGRQGEIRRNCRVVNSASVVGTISASPAGSVNTDGFASDV*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACTAATAATGCCTGCTAAGTTTCTAGTTCCTTCTTTGTTGGCATTATTAATGCTGGTTTCTGCTGGTCGTCGGAGCTATGCGCAGCAGCTTACTCCGACGTACTACGACTCC
ACTTGTCCCGCTGTTATAAACATCGTCCGTCGGGTCCTCGAAAATGCTGCCGTGGCTGATACCAGGATTTGTGCCAGCCTCATTAGGCTTCACTTCCACGATTGCTTCGTTAGT
GTAAGT
ACCGTGTGATATAATACTATTATACTATTATATTTTTCAGAACAGTACTACCAGAACATATGACTGTCTATCTGACGGCTATGAATGGCCATAGGAGATTTGCCGGTTGAGATGAAAAGA
ACATCAGAAATATGTGCCACTGTTAGGACTGAATCTGCTCAAAATAGGGGCTGCTGCTGTTGTTTTGTAAACCAGCCAGTTTAACGGTGGATAAGAACCACGCTTAATTTAAGCAATAAA
CCGCTGTTAGTTTAACTGCGGTTCCGGTCCGCTCTTAAGTTAAGAATTAGTTTAACTGCAGCTCCATCCGCTGTTAAGTTAAGAATCCGCGGTTAGCAGGTTTAGCATTACTTAAGCTAA
CAACGGAAATATATCCATCGTTAGCATAAAGCTAACGGCATCTTATTTCCTCTTAAACTAGAAAAATAACGGTCGTTAGCATAGCGAATTCTTGTAGTGTGTCTCTCCACCTCCTCCGGG
AGAAGATGACTAGCTAGATGCATGGCGCCACTTTCACTTTTTTGCGGTTTCATCCAAACCGTCAGATCTCTCACGACTCACGACCATTCTAGGATGGGCGTCAGGAGGTGCTGACGAATT
GTGATTCACATTACACCGTTACAAATTTTAGTCCCGTTTTGATGAGTGATTCAAGGTGTTAGCATGCAGGGATGTGATGCATCATTGCTGTTGGACAACAGTCCGACGATATTAAGCGAG
AAAGAAGCCGTCGGTAATAACAACTCTTGTAGAGGGTATGAAGTCATTGATCAGATGAAGACCCAAATCGAGGCTGCATGTCCAGGGGTCGTTTCCTGCGCCGATATTCTCGCCATCGCC
GCAGAAGAATCCGTTGTTTTG
GTAAGTATGTCTTTTGAGGTTGTGATACGTCGTCGTGCTGACATGGATATGAATTGTAGGCAGGAGGGCCATCGTGGGCGGTCCCACTGGGAAGGCTAG
ACAGCTTGACGGCGAACCAAAGGAGTCTAGTGACTTCATCCCTTCCTCATATGAATTACACCGTCGATGAGCTCAAAGCTAACTTCGCCGCCGTCGGCCTCGACACCACCGTCGACCTCG
TTGCACTCTCAG
GTTATCATAACAAATATTAAATAATTAATAATCCCGGTCGATCTCGTTTAATTAATTAATTAATTGTTGTGGGTCTTAGGTGCTCACACGTTCGGGAGGGTCCAGTGC
AAAGGATTCATGTCGCGAATCTACAACTTTAACAACACGGGAGCCCCAGACCCAACACTGAATGCCACGTTGCGCAACTCGCTCCGTCAGCTTTGCCCTGAGGACCGAACCGACATCGTT
TTCACGGACCTCGACAAAACAACCCCTAACGCATTCGACTCGGCCTACTTCAGAAACCTCCAGACAGGAGAAGGAATCATCTGGAGCGACCAGGTTCTCTTCTCCACTCCGAGGTCCGAC
ACTGTTGATATTGTCAATAGGTTCGCTGCCAACGAGACGGCCTTCTTTGAGAGCTTTGTTGATTCGATGATTAGGATGGGGAACATTGCGCCTCCGGCGGGGAGGCAGGGTGAGATTCGG
CGGAATTGCAGAGTTGTTAACTCTGCCTCCGTCGTCGGTACGATTAGTGCTTCTCCGGCCGGTTCTGTTAATACTGATGGTTTTGCGAGTGATGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACTAATAATGCCTGCTAAGTTTCTAGTTCCTTCTTTGTTGGCATTATTAATGCTGGTTTCTGCTGGTCGTCGGAGCTATGCGCAGCAGCTTACTCCGACGTACTACGACTCC
ACTTGTCCCGCTGTTATAAACATCGTCCGTCGGGTCCTCGAAAATGCTGCCGTGGCTGATACCAGGATTTGTGCCAGCCTCATTAGGCTTCACTTCCACGATTGCTTCGTTAGT
GGATGT
GATGCATCATTGCTGTTGGACAACAGTCCGACGATATTAAGCGAGAAAGAAGCCGTCGGTAATAACAACTCTTGTAGAGGGTATGAAGTCATTGATCAGATGAAGACCCAAATCGAGGCT
GCATGTCCAGGGGTCGTTTCCTGCGCCGATATTCTCGCCATCGCCGCAGAAGAATCCGTTGTTTTG
GCAGGAGGGCCATCGTGGGCGGTCCCACTGGGAAGGCTAGACAGCTTGACGGCG
AACCAAAGGAGTCTAGTGACTTCATCCCTTCCTCATATGAATTACACCGTCGATGAGCTCAAAGCTAACTTCGCCGCCGTCGGCCTCGACACCACCGTCGACCTCGTTGCACTCTCAG
GT
GCTCACACGTTCGGGAGGGTCCAGTGCAAAGGATTCATGTCGCGAATCTACAACTTTAACAACACGGGAGCCCCAGACCCAACACTGAATGCCACGTTGCGCAACTCGCTCCGTCAGCTT
TGCCCTGAGGACCGAACCGACATCGTTTTCACGGACCTCGACAAAACAACCCCTAACGCATTCGACTCGGCCTACTTCAGAAACCTCCAGACAGGAGAAGGAATCATCTGGAGCGACCAG
GTTCTCTTCTCCACTCCGAGGTCCGACACTGTTGATATTGTCAATAGGTTCGCTGCCAACGAGACGGCCTTCTTTGAGAGCTTTGTTGATTCGATGATTAGGATGGGGAACATTGCGCCT
CCGGCGGGGAGGCAGGGTGAGATTCGGCGGAATTGCAGAGTTGTTAACTCTGCCTCCGTCGTCGGTACGATTAGTGCTTCTCCGGCCGGTTCTGTTAATACTGATGGTTTTGCGAGTGAT
GTTTGA

Retrieve as FASTA