Entry information : LuPrx148(Lus10027983|PACid:23181178)
Entry ID 12095
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx148(Lus10027983|PACid:23181178)
Name LuPrx148(Lus10027983|PACid:23181178)
Class Class III peroxidase    [Orthogroup: Prx166]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx148
start..stop
S start..stop
LuPrx45 664 0 6..362 1..357
LuPrx149 507 0 9..362 5..355
LuPrx01 498 1.96e-178 1..362 1..360
LuPrx151 489 4.55e-175 11..362 9..361
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12095' 'join(176058..176291,176967..177158,177218..177389,177469..177956)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 176058..176291 232 N° 2 176967..177158 190 N° 3 177218..177389 170 N° 4 177469..177956 486
join(176058..176291,176967..177158,177218..177389,177469..177956)


exon

Literature and cross-references LuPrx148(Lus10027983|PACid:23181178)
DNA ref. Phytozome 12:   scaffold132 (176058..177956)
Protein sequence: LuPrx148(Lus10027983|PACid:23181178)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (331)
PWM (Da):   %s   38794.4 (35494.5)  
PI (pH):   %s   4.88 (4.67) Peptide Signal:   %s   cut: 31 range:31-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLIMPAKFLVPSLLALLMLVSAGRRSYAQQLTPTYYDSTCPAVINIVRRVLENAAVADTRICASLIRLHFHDCFVSGCDASLLLDNSPTILSEKEAVGNNNSCRGYEVIDQMKTQIEA
ACPGVVSCADILAIAAEESVVLAGGPSWAVPLGRLDSLTANQRSLVTSSLPHMNYTVDELKANFAAVGLDTTVDLVALSGAHTFGRVQCKGFMSRIYNFNNTGAPDPTLNATLRNSLRQL
CPEDRTDIVFTDLDKTTPNAFDSAYFRNLQTGEGIIWSDQVLFSTPRSDTVDIVNRFAANETAFFESFVDSMIRMGNIAPPAGRQGEIRRNCRVVNSASVVGTISASPAGSVNTDGFASD
V*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACTAATAATGCCTGCTAAGTTTCTAGTTCCTTCTTTGTTGGCATTATTAATGCTGGTTTCTGCTGGTCGTCGGAGCTATGCGCAGCAGCTTACTCCGACGTACTACGACTCC
ACTTGTCCCGCTGTTATAAACATCGTCCGTCGGGTCCTCGAAAATGCTGCCGTGGCTGATACCAGGATTTGTGCCAGCCTCATTAGGCTTCACTTCCACGATTGCTTCGTTAGT
GTGTAA
GTACCGTGTGATATAATACTATTATACTATTATATTTTTCAGAACAGTACTACCAGAACATATGACTGTCTATCTGACGGCTATGAATGGCCATAGGAGATTTGCCGGTTGAGATGAAAA
GAACATCAGAAATATGTGCCACTGTTAGGACTGAATCTGCTCAAAATAGGGGCTGCTGCTGTTGTTTTGTAAACCAGCCAGTTTAACGGTGGATAAGAACCACGCTTAATTTAAGCAATA
AACCGCTGTTAGTTTAACTGCGGTTCCGGTCCGCTCTTAAGTTAAGAATTAGTTTAACTGCAGCTCCATCCGCTGTTAAGTTAAGAATCCGCGGTTAGCAGGTTTAGCATTACTTAAGCT
AACAACGGAAATATATCCATCGTTAGCATAAAGCTAACGGCATCTTATTTCCTCTTAAACTAGAAAAATAACGGTCGTTAGCATAGCGAATTCTTGTAGTGTGTCTCTCCACCTCCTCCG
GGAGAAGATGACTAGCTAGATGCATGGCGCCACTTTCACTTTTTTGCGGTTTCATCCAAACCGTCAGATCTCTCACGACTCACGACCATTCTAGGATGGGCGTCAGGAGGTGCTGACGAA
TTGTGATTCACATTACACCGTTACAAATTTTAGTCCCGTTTTGATGAGTGATTCAAGGTGTTAGCATGCAGGGATGTGATGCATCATTGCTGTTGGACAACAGTCCGACGATATTAAGCG
AGAAAGAAGCCGTCGGTAATAACAACTCTTGTAGAGGGTATGAAGTCATTGATCAGATGAAGACCCAAATCGAGGCTGCATGTCCAGGGGTCGTTTCCTGCGCCGATATTCTCGCCATCG
CCGCAGAAGAATCCGTTGTTTTG
TGGTAAGTATGTCTTTTGAGGTTGTGATACGTCGTCGTGCTGACATGGATATGAATTGTAGGCAGGAGGGCCATCGTGGGCGGTCCCACTGGGAAGG
CTAGACAGCTTGACGGCGAACCAAAGGAGTCTAGTGACTTCATCCCTTCCTCATATGAATTACACCGTCGATGAGCTCAAAGCTAACTTCGCCGCCGTCGGCCTCGACACCACCGTCGAC
CTCGTTGCACTCTCAG
AGGTTATCATAACAAATATTAAATAATTAATAATCCCGGTCGATCTCGTTTAATTAATTAATTAATTGTTGTGGGTCTTAGGTGCTCACACGTTCGGGAGGGTC
CAGTGCAAAGGATTCATGTCGCGAATCTACAACTTTAACAACACGGGAGCCCCAGACCCAACACTGAATGCCACGTTGCGCAACTCGCTCCGTCAGCTTTGCCCTGAGGACCGAACCGAC
ATCGTTTTCACGGACCTCGACAAAACAACCCCTAACGCATTCGACTCGGCCTACTTCAGAAACCTCCAGACAGGAGAAGGAATCATCTGGAGCGACCAGGTTCTCTTCTCCACTCCGAGG
TCCGACACTGTTGATATTGTCAATAGGTTCGCTGCCAACGAGACGGCCTTCTTTGAGAGCTTTGTTGATTCGATGATTAGGATGGGGAACATTGCGCCTCCGGCGGGGAGGCAGGGTGAG
ATTCGGCGGAATTGCAGAGTTGTTAACTCTGCCTCCGTCGTCGGTACGATTAGTGCTTCTCCGGCCGGTTCTGTTAATACTGATGGTTTTGCGAGTGATGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACTAATAATGCCTGCTAAGTTTCTAGTTCCTTCTTTGTTGGCATTATTAATGCTGGTTTCTGCTGGTCGTCGGAGCTATGCGCAGCAGCTTACTCCGACGTACTACGACTCC
ACTTGTCCCGCTGTTATAAACATCGTCCGTCGGGTCCTCGAAAATGCTGCCGTGGCTGATACCAGGATTTGTGCCAGCCTCATTAGGCTTCACTTCCACGATTGCTTCGTTAGT
GGATGT
GATGCATCATTGCTGTTGGACAACAGTCCGACGATATTAAGCGAGAAAGAAGCCGTCGGTAATAACAACTCTTGTAGAGGGTATGAAGTCATTGATCAGATGAAGACCCAAATCGAGGCT
GCATGTCCAGGGGTCGTTTCCTGCGCCGATATTCTCGCCATCGCCGCAGAAGAATCCGTTGTTTTG
GCAGGAGGGCCATCGTGGGCGGTCCCACTGGGAAGGCTAGACAGCTTGACGGCG
AACCAAAGGAGTCTAGTGACTTCATCCCTTCCTCATATGAATTACACCGTCGATGAGCTCAAAGCTAACTTCGCCGCCGTCGGCCTCGACACCACCGTCGACCTCGTTGCACTCTCAG
GT
GCTCACACGTTCGGGAGGGTCCAGTGCAAAGGATTCATGTCGCGAATCTACAACTTTAACAACACGGGAGCCCCAGACCCAACACTGAATGCCACGTTGCGCAACTCGCTCCGTCAGCTT
TGCCCTGAGGACCGAACCGACATCGTTTTCACGGACCTCGACAAAACAACCCCTAACGCATTCGACTCGGCCTACTTCAGAAACCTCCAGACAGGAGAAGGAATCATCTGGAGCGACCAG
GTTCTCTTCTCCACTCCGAGGTCCGACACTGTTGATATTGTCAATAGGTTCGCTGCCAACGAGACGGCCTTCTTTGAGAGCTTTGTTGATTCGATGATTAGGATGGGGAACATTGCGCCT
CCGGCGGGGAGGCAGGGTGAGATTCGGCGGAATTGCAGAGTTGTTAACTCTGCCTCCGTCGTCGGTACGATTAGTGCTTCTCCGGCCGGTTCTGTTAATACTGATGGTTTTGCGAGTGAT
GTTTGA

Retrieve as FASTA