1. Browse the Database
  2. View Redoxidase
Entry information : LuPrx151(Lus10027989|PACid:23181253)
Entry ID 12099
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx151(Lus10027989|PACid:23181253)
Name LuPrx151(Lus10027989|PACid:23181253)
Class Class III peroxidase    [Orthogroup: Prx166]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx151
start..stop		 S start..stop
LuPrx42 674 0 16..361 16..373
LuPrx149 578 0 8..361 5..355
LuPrx01 569 0 1..361 1..360
LuPrx43 521 0 13..361 5..359
Gene structure Fichier Exons►


exon

Literature and cross-references LuPrx151(Lus10027989|PACid:23181253)
DNA ref. Phytozome 12:   scaffold132 (206402..204376)
Protein sequence: LuPrx151(Lus10027989|PACid:23181253)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (333)
PWM (Da):   %s   38245.06 (35443.6) Transmb domain:   %s   i5-27o
PI (pH):   %s   6.25 (6.73) Peptide Signal:   %s   cut: 28 range:28-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVVSMSSLVASSLVAIMLLFAGASYAQQLTPAFYNPTCPNLATIVRQVLQNAAMTDPRIGASMIRLHFHDCFVNGCDGSILLDNSATIVSEKQAAPNNNSVRGFEVIDQMKTQVEAACP
GIVSCADILTIASKESVVLAGGPSWAVPLGRRDSLTANRTLANSALPPPFFTVPQLKAAFNAVGLNTTTDLVALSGAHTFGRAACGGFVGRLYNFNNTGGSDPTLNATFLQTLRQLCPQN
GNASVLANLDKTTANTFDSAYFRNLQTREGLLQSDQELFSTPGSDTIAIVNRFATNQTAFFQSFVNSMIRMGNIRPPVGSPSQIRRNCRVVNSASTDFMDDSIITTPTGIVDTDGFASDM
*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA ►
Send to BLAST
CDS►
Send to BLAST