Entry information : LuPrx152(Lus10028337|PACid:23166155)
Entry ID 12100
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx152(Lus10028337|PACid:23166155)
Name LuPrx152(Lus10028337|PACid:23166155)
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx152
start..stop
S start..stop
LuPrx209 447 5e-160 5..281 28..331
RcPrx17 400 1e-141 3..281 25..330
CroPrx06 399 3e-141 1..281 23..330
MePrx01 399 6e-141 1..281 23..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 171188..171220 33 N° 2 169075..169200 126 N° 3 168784..168975 192 N° 4 168127..168432 306
N° 5 167838..168026 189  
complement(join(167838..168026,168127..168432,168784..168975,169075..169200,1711 88..171220))


exon

Literature and cross-references LuPrx152(Lus10028337|PACid:23166155)
DNA ref. Phytozome 12:   scaffold413 (171220..167838)
Protein sequence: LuPrx152(Lus10028337|PACid:23166155)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   281
PWM (Da):   %s   30772.61  
PI (pH):   %s   9.1
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
APAQGNWRPGTFYDYSCPQAHQIVKSVVAKAVAKEPRMAASLLRLHFHDCFVKGCDASILLDGGSGIATEKNSNPNRNSARGFEVIDDIKSALEKECPNKVSCADILTLAARDSTVLAGGPSWEVPLGRKDSRSASLSGSNNNIPAPNNTFQTILTKFKLQGLNTVDLVALSGSHALTRNPHNGEFGVHEFPTEAVQPDRKRPTRFQPRFHLCLPVENQGLLNSDQVLLTKNEASMELVKQYAENNELFFQQFAKSMVKMGNISPLTGSKGEIRKNCRKMN*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end and PS are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCCAGCTCAAGGAAACTGGAGGCCCGGCACTGTAAGATACGGCTCAATTTAAGCTCCAAGTTCTCCGAATTCGAGATAGATATGGAATGCACACAATTTTTGTTGTGTGAAACGCTTA
GAGAGCATGGATTCGTCATAGTTGGTAGTGAGAATACATTAGTTTTGAAACTCATAACACCATCTCAGGTACAATTGTTCTGAAAACATTAGTGTTGAGTTTCTTCTTCAGGTTATAATC
GATTTCTCATGGTCCATCGGATAGCATCTATGCATATACTGTTTTGAACATGATTTAATTGTGAATCTTTCAAGATATGGTCAAACCAATTGTTTCTTGAGATTTCAAGGGTTAGGAAAG
TTTTTGGAGCAGTTATACAACGCAGTGTGGTTGGTGTTTGAAGAACTGATGATCATAAACTTTTTCCCTGAAACCTGACAAAAATGTAAACCAACCCTTTAAAATCACCAAACATAATAT
GAAATCTTTTTCCTACAACCATTCCATTAACATCTAGAATCTTGAAACCTAAATAGAAACAACTATTTACCACCATACACCACCTCCTTTTTTCAAGTTTTTAGAGATGATCCTACTCGG
AAGAATATTGATGTTTCAGAGAAAACGACAGGAAAAAAGGAGTTTACTTTGTGGTTTATTGCAGAGGTTTTGTTTATGGACGGTCTACATTGCTGGGTGAGATTGTGCAATTTGTCAACA
GAGCAGTTGAATCATTGGTTTGTAATTGAGGACTTTAGTTGTGATTTTTTTTGTCCTTACGTTGGTGCCTGGCTATAGAATAAAGTACCGACGCCGCGTGGTGGCCAAGCTCCAGTTTTG
TTGTTTGACAGAACACATGCACGACTTGGCTTCTCTAGAACAGTTAATAAAATTATGCCAGGGATGATTTTAACAGTTAAATCGTGTTAGGATTGGTCCTGAAAGTTTTGGATTTGCTAC
TGGTCACAGCCCACAACTACAAACAGACATCTTGGTTTTTCGGTTACGAAATTTTCTCGTAAAAAAAGTTGAGTATGGGTTTTACCGTTCGAAGACATTCGATAAAATTGGAATGATGAG
ACCATTATCAAACACATTTAACAATGTTATCATATAATCTCTGACTTTGTCCAATGCCATAAAAAATTGGCTGTTCTACTAACTAATTCAACTGTTCTTCCAGATTGCTTACATCATAGT
CTTCCCCTCTGTCTCCCATACTTGTAACTTTCTCCATTTAATTCATAAAATAATTAGTTTGAAATTTAAATCATGAACATCATTAAACTATCTCCTTACTAAAGAAATGGCCAGAGTTTG
AAATGTTCAATATCAAGGTCAACTAGCACAAGAGGTGGGTAAAAACAGATTGTAGCATGATAGAGACGAAACCAATCAATCATTTCTTTATGATAAACCAATCGATCAGAATGCAGTTCA
TCTCTCCAGAAAGATCGACTTAACTATTTTGAAAGTTTGCTGAACATTTTTTTGATCATGTCTGGATGAGGGTCAACGCACTCTCTTCACATTGAACTCAACAGATTCCCAGAACAACAA
ACGTCTCGGAAAGGATCTAGATCATGTCTGGATGCAGGGGTTAGACACGAATTAGTGTTTATGTGTATCAGTTGTTAGAACTGTTACTGTGCTCTCATGATTGCCAAGTCAGTCGACTGA
TCATAAAGACTTATTATTTGTAACTTATAACTACTCCAATTTTCTACTTTTCTTCCTTTACCATTTCTTTAATCAAATGCAAAATCAGTCAGTTACCAACTCCATATTTTATGTTCCCTT
TCCCTTATCGTGTCAGAGCTCATTCACAGAACTTTCCACCTATAAATAGGGTTCCACCCTATGCAACAGCTTCCATCACAGCAGCAGCAACTTTATAGCAGACTAGCAATTACTAATCAT
GGCTCGATCTGTTAGCTTTGTTTTCGTTGTTGTCTCTCTTCTAGCGTTTGCTCCATTTTGCTTATGTGGTAAGAACATTGGTGGGTACCTTTACCCTCAGTTCTATGACTACTCTTGCCC
TCAAGCTCACCAGATTGTCAAGTCTGTTGTGGCCAAGGCAGTTGCCAAAGAACCCCGGATGGCTGCTTCGTTGCTCAGGCTGCATTTCCATGACTGCTTCGTAAAG
GTTTCGACTTTGCC
TTGACCCCAAAAAACGTTAACAGTTCTTTTGTCACCAACTAATAGGTTATTTCTGAATTAATTATATGTAATTTTGTTGTACCAGGGATGTGATGCTTCAATCCTGCTGGATGGAGGTTC
AGGCATTGCAACTGAGAAGAACTCGAATCCGAATCGGAATTCTGCGAGAGGATTCGAAGTGATCGATGACATCAAGTCTGCATTGGAGAAGGAATGTCCTAACAAAGTTTCTTGTGCTGA
TATCCTGACCCTAGCTGCCAGAGACTCCACTGTACTT
GTGAGTGTTCTGTGTTTCTTCACTTTGTAATTAACTTTTCTCTCGAGTATAGACCAACCTTTCATCGCAGTAAGTTGAGTTAT
TGGGAAAAAGGTTGATAATTAGTTTTTATATCAGTCATTTACATCCATGAGAGGGGATTGAAGTTTGCACAGGTCCACTAAACCTTATGCATATGAAATTGTCATATTAGAGGCTGTCAG
GATTCAATCTTGAAACCTCTCAGAAAAATTGAACAGTAAGAAGGCTCTGTGGAGAATCATATCCCAATATATCTGAGTTGTTAGGAAAGATTCCTGATAAGCTTTTATAAGCCTGGAATC
CTAAAACAATGTTGTTCCTTTCTTGAAGGCTGGAGGACCAAGCTGGGAGGTACCACTGGGGAGAAAGGACTCAAGAAGTGCAAGCTTGAGTGGTTCCAACAACAACATTCCAGCTCCAAA
CAACACATTCCAGACAATCCTGACAAAGTTCAAGCTCCAAGGCCTTAACACTGTGGACCTTGTAGCATTGTCAGGAAGCCACGCGTTAACAAGAAACCCACACAATGGGGAATTCGGGGT
GCACGAGTTTCCGACAGAGGCTGTACAACCAGACAGGAAACGGCCGACCAGATTCCAGCCTCGATTCCACCTATGCCTCCCAGTTGAAAACCAG
GTGCCCTCGTTCAGGAGGCGATCAGA
ACCTGTTCTTCTTGGATTTCCAGACTCCGATGCATTTCGATAACAGCTACTTCAAGAACATATTGGCTTCAAAGGGGCTGCTCAACTCTGACCAGGTTCTCCTCACGAAGAATGAAGCAT
CCATGGAGTTGGTCAAGCAGTACGCTGAGAATAACGAGCTTTTCTTCCAGCAGTTTGCTAAGTCGATGGTTAAGATGGGAAATATCTCACCTTTGACTGGCTCCAAGGGAGAAATAAGGA
AGAACTGCAGGAAGATGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCCAGCTCAAGGAAACTGGAGGCCCGGCACTTTCTATGACTACTCTTGCCCTCAAGCTCACCAGATTGTCAAGTCTGTTGTGGCCAAGGCAGTTGCCAAAGAACCCCGGATGGCTGCT
TCGTTGCTCAGGCTGCATTTCCATGACTGCTTCGTAAAG
GGATGTGATGCTTCAATCCTGCTGGATGGAGGTTCAGGCATTGCAACTGAGAAGAACTCGAATCCGAATCGGAATTCTGCG
AGAGGATTCGAAGTGATCGATGACATCAAGTCTGCATTGGAGAAGGAATGTCCTAACAAAGTTTCTTGTGCTGATATCCTGACCCTAGCTGCCAGAGACTCCACTGTACTT
GCTGGAGGA
CCAAGCTGGGAGGTACCACTGGGGAGAAAGGACTCAAGAAGTGCAAGCTTGAGTGGTTCCAACAACAACATTCCAGCTCCAAACAACACATTCCAGACAATCCTGACAAAGTTCAAGCTC
CAAGGCCTTAACACTGTGGACCTTGTAGCATTGTCAGGAAGCCACGCGTTAACAAGAAACCCACACAATGGGGAATTCGGGGTGCACGAGTTTCCGACAGAGGCTGTACAACCAGACAGG
AAACGGCCGACCAGATTCCAGCCTCGATTCCACCTATGCCTCCCAGTTGAAAACCAG
GGGCTGCTCAACTCTGACCAGGTTCTCCTCACGAAGAATGAAGCATCCATGGAGTTGGTCAAG
CAGTACGCTGAGAATAACGAGCTTTTCTTCCAGCAGTTTGCTAAGTCGATGGTTAAGATGGGAAATATCTCACCTTTGACTGGCTCCAAGGGAGAAATAAGGAAGAACTGCAGGAAGATG
AATTAA

Retrieve as FASTA