Entry information : LuPrx154(Lus10028631|PACid:23164591)
Entry ID 12101
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx154(Lus10028631|PACid:23164591)
Name LuPrx154(Lus10028631|PACid:23164591)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx154
start..stop
S start..stop
LuPrx101 560 0 1..322 1..325
GhPrx35 355 4e-123 16..322 20..327
GaPrx08 354 1e-122 16..322 20..327
RcPrx01 342 4e-118 1..322 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 492573..492785 213 N° 2 492873..493046 174 N° 3 493859..494024 166 N° 4 494128..494543 416
join(492573..492785,492873..493046,493859..494024,494128..494543)


exon

Literature and cross-references LuPrx154(Lus10028631|PACid:23164591)
DNA ref. Phytozome 12:   scaffold346 (492573..494543)
Protein sequence: LuPrx154(Lus10028631|PACid:23164591)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (298)
PWM (Da):   %s   35296.56 (32444.2)  
PI (pH):   %s   5.44 (5.44) Peptide Signal:   %s   cut: 25 range:25-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCFTSNPLFLSFFFLFLLQASNGQLQFGFYANSCPAAEQVVFNAVQQASLSEPRTAARLLRLSFHDCFVEGCDGSILLNGGEQTASGNQGLGSFEVIETAKERLERLCPGVVSCADIVALAARDAITLSHGPVFNIPTGRRDGRVNDVKNAASLPDVNDSADDMSDKFRQKGLSVKDLVLLTAGGHTIGTTACFFMTDRLYQFRPPTTMTDPTINPVLLRELERMCPKGGDVNDRVRMDWSTPDAMDDKIIRNIQRGFAVLASDARLADNREAVDIMNSYLSTNNATAFIFDFAEAMVKMGTMAVKTRTQGEIRRKCNVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGTTTCACTTCCAACCCTCTGTTTCTCTCCTTCTTCTTCCTCTTCCTCCTCCAAGCATCAAATGGTCAGCTCCAGTTCGGCTTCTACGCCAACTCCTGCCCTGCCGCCGAGCAA
GTCGTCTTCAATGCAGTCCAGCAAGCCAGCCTCTCCGAACCCCGCACCGCCGCCCGCCTCCTCCGCCTCTCCTTCCATGACTGCTTCGTCGAG
GTTCGTCACAAAAACTGAAACTTTTTA
ACTACTTTGATTCTTTCTGTTTGTTTTGATCAGGCTCTGTTCTTTTGTGAAATTGAAAAGGGTTGTGACGGCTCCATATTGCTGAACGGAGGGGAACAGACTGCGTCTGGGAATCAAGGG
CTGGGATCGTTTGAGGTGATCGAAACGGCTAAAGAACGGCTGGAAAGATTGTGCCCTGGAGTCGTCTCTTGCGCGGACATTGTGGCTTTAGCTGCTCGTGACGCCATTACCTTG
GTACGC
TCACACAAGTTTCCTCCAATCCTCTGTTTTTCTCTTTGGTTTGGAAATCCTCTGTTTTTTTTTATTCTGTGGGTAGTAGTAGTAGTAACAAATTTTTTACTGAATTTAACCTTGTGGTAA
TGTAAGGATAAACATGTTTTTTACGAGGAAGTTTCTTGAGAATCAAGATAGCGGAACGACTTATATTAAATTAGAATAAATATAGATCATTTTAAAACTCGTGATAGGTGGATATCGAGG
GTGATGTTCGGTGGTCGAATGAGGGATGAGTCAATACGGATTATTTTTTAAGGTCTTAAGTCCCCAAATTGCGGAATCAAAATTATGTAAAATTTTCAAAAGTTATATTTGGATTTGAAA
TATTATATTAGTTGACTTTTTCACAGTTGAAGTCAACTAATATAAAATTTCTTTCATTTTTCAAAAGTTTATATAAAATGCCCTTAATAGTGACCTGAATTAACCTTAAATAGTGACCTG
AATTAACCTACACCTGATTTCGTCATTGATAACGAGCTGGTTATTTCGCCCGTGCCTTCTTTTCGGGTCGGTTTTAGGTGTTTGTGATGTGCCATTATCATACTAGTTCATGCTTGACGT
GCATACACAGTTAGATGTTCAAGTTGTTTACCATTGAATAAACAGAGTCCCTTGGATATCTCTCAAATACAGTGATGGAGGATTTCGTGAGTTGAATGGATGTTTAGAATTTTGTGTTTG
CTTACTATCTGGTTATCTCGGTTTGAAACTATGGTAATTATGCTACAAGTTCACTGATTTTTTTTTCTGTTTTGACCAATTGACAGAGTCATGGGCCAGTTTTTAACATTCCAACGGGGA
GAAGAGACGGCAGAGTTAACGATGTTAAAAATGCTGCCAGTTTGCCGGACGTCAACGATTCCGCCGATGATATGAGCGACAAGTTCCGTCAGAAAGGATTGTCCGTTAAAGATCTCGTCC
TTCTCACCGCAG
GTAACGCTACGACGTCGTATTTACGATTCGAGACTGGACCATTCGGTTGAACCGACCGAACAAAATTTTCGGCTAAACTAGACTCCGTGTTTTCTTATTTCAGGAGGG
CACACAATTGGGACGACGGCGTGTTTCTTCATGACGGATCGGCTCTACCAATTCAGACCTCCGACGACCATGACCGACCCGACCATTAACCCGGTTCTCTTGCGGGAGCTGGAAAGGATG
TGCCCGAAAGGGGGCGACGTCAATGACCGAGTGCGTATGGACTGGTCGACACCGGACGCGATGGACGACAAGATCATTCGCAACATCCAGAGGGGGTTCGCAGTGCTGGCATCCGACGCA
AGGCTGGCAGATAACCGGGAGGCAGTCGATATTATGAATTCTTACTTGAGTACCAACAATGCGACGGCGTTTATCTTCGACTTTGCCGAGGCCATGGTGAAAATGGGGACAATGGCTGTT
AAAACGAGGACCCAAGGTGAAATCAGGAGGAAATGCAACGTGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGTTTCACTTCCAACCCTCTGTTTCTCTCCTTCTTCTTCCTCTTCCTCCTCCAAGCATCAAATGGTCAGCTCCAGTTCGGCTTCTACGCCAACTCCTGCCCTGCCGCCGAGCAA
GTCGTCTTCAATGCAGTCCAGCAAGCCAGCCTCTCCGAACCCCGCACCGCCGCCCGCCTCCTCCGCCTCTCCTTCCATGACTGCTTCGTCGAG
GGTTGTGACGGCTCCATATTGCTGAAC
GGAGGGGAACAGACTGCGTCTGGGAATCAAGGGCTGGGATCGTTTGAGGTGATCGAAACGGCTAAAGAACGGCTGGAAAGATTGTGCCCTGGAGTCGTCTCTTGCGCGGACATTGTGGCT
TTAGCTGCTCGTGACGCCATTACCTTG
AGTCATGGGCCAGTTTTTAACATTCCAACGGGGAGAAGAGACGGCAGAGTTAACGATGTTAAAAATGCTGCCAGTTTGCCGGACGTCAACGAT
TCCGCCGATGATATGAGCGACAAGTTCCGTCAGAAAGGATTGTCCGTTAAAGATCTCGTCCTTCTCACCGCAG
GAGGGCACACAATTGGGACGACGGCGTGTTTCTTCATGACGGATCGG
CTCTACCAATTCAGACCTCCGACGACCATGACCGACCCGACCATTAACCCGGTTCTCTTGCGGGAGCTGGAAAGGATGTGCCCGAAAGGGGGCGACGTCAATGACCGAGTGCGTATGGAC
TGGTCGACACCGGACGCGATGGACGACAAGATCATTCGCAACATCCAGAGGGGGTTCGCAGTGCTGGCATCCGACGCAAGGCTGGCAGATAACCGGGAGGCAGTCGATATTATGAATTCT
TACTTGAGTACCAACAATGCGACGGCGTTTATCTTCGACTTTGCCGAGGCCATGGTGAAAATGGGGACAATGGCTGTTAAAACGAGGACCCAAGGTGAAATCAGGAGGAAATGCAACGTG
GTTAATTAA

Retrieve as FASTA