Entry information : LuPrx158(Lus10028736|PACid:23164625)
Entry ID 12104
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx158(Lus10028736|PACid:23164625)
Name LuPrx158(Lus10028736|PACid:23164625)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx158
start..stop
S start..stop
LuPrx155 577 0 1..305 30..338
EgrPrx151 419 5e-149 4..305 13..315
EguPrx153 414 4e-147 4..305 13..315
EcamPrx151 414 5e-147 4..305 21..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1132925..1133077 153 N° 2 1133854..1134291 438 N° 3 1134370..1134696 327  
join(1132925..1133077,1133854..1134291,1134370..1134696)


exon

Literature and cross-references LuPrx158(Lus10028736|PACid:23164625)
DNA ref. Phytozome 12:   scaffold346 (1132925..1134696)
Protein sequence: LuPrx158(Lus10028736|PACid:23164625)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   306
PWM (Da):   %s   32803.33  
PI (pH):   %s   8.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEAALKPGFYKSSCPSAESVVKRVVTRAVSRDSNLGAGLIRMHFHDCFIRGCDASVLLKSSPGGNQTERDHPANNPSLRGFEVIDSAKSELELVCPNTVSCADIIAFAARDSSFILGRINYGVPAGRRDGRVSSSDDIGANLPPPSFSAEQLAQNFARKGLTTEEMVVLSGAHSIGVAHCSSFANRLYSFNRTHPQDPTLDSTYATELKRRCPNDGGNAAADLDSTPNRLDNRYFADLKRRRGILSSDQTLMDSTLTRNIAMKFASGNGGAWAGRYAKAMVKMGSIEVLTGNNGEIRKICSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGAGGCTGCTCTGAAGCCAGGCTTCTACAAGTCATCGTGCCCATCGGCTGAATCCGTCGTCAAGAGGGTCGTGACCAGGGCCGTGTCTCGCGATTCAAACCTTGGAGCCGGACTC
ATTAGGATGCACTTCCACGACTGCTTTATCAGG
GTGCGTCTACCTAGCTTAATCACCCTCTCTCTCTCTCCCTCTTCTTGATTTTCCATTGTTCAAATTCTATGTGGGAAAATGCACTTT
AGAGACTGTAATTCATTGATCGTTAACGATCACTAACCTGCTGATCACTAAAGGTCATCAAGATGACCGTTTAAGGTTTTGGGGACCGTTTTTTAGTTTTTGATCGAATAAATAACTACC
AATTTGAAACCCTCTTTCAATAATTTGAGTTATTGGGATACAATAGTTTTTTCATGGTATGAGAGTCTAAAAAGATAAAGAGGTAAGTATCCGTTTCAAATCTCGATAGCCACTAATTCC
TGCATATAACTTACCTAAGTTGTGCAAACCTCATTTCTTTTGAAAGTTTTTAATTGATAGGGGCATGTTGATGAACATATAAAAAATTAAAAACCAATTTAAACTCTGTTTCAACAACGT
AAGTTATTAGAATGCAACCTTTCTTGATAAATCGATTATATATATAATAGCTAAGTGGAAATTAATTACTAGATTGACCATGTATGTAAGGTCAAAGCTTTGATCTTATTGTAGTGGGTA
GAATTTGATCAAAATCATATGTAGTGTAAGATTAAGTTACTCAAATGTATCAACTTTATGCTAGGGTAAATGGTTCGATCAGTTGGTTTGAGTCAATTGGTTTGATTAATTTTAGTTAGA
TTACATTTGCTACATTGTGTTATAGTATATGTATTTATGAATGTATTTAGCATAACTTATACAATTACTTTATTTTTGTTAATAATTAGGGATGTGACGCATCGGTCCTCCTGAAATCCT
CCCCGGGAGGGAACCAAACCGAGAGAGACCATCCGGCCAACAACCCGAGCCTAAGAGGATTCGAGGTAATCGACTCGGCCAAATCGGAACTCGAATTAGTCTGCCCAAACACCGTCTCAT
GCGCCGACATTATCGCCTTTGCCGCTCGGGACAGCTCATTCATCCTCGGACGCATCAACTACGGCGTCCCCGCCGGTCGTCGCGATGGCCGCGTTTCGTCTTCCGACGATATCGGCGCTA
ACCTCCCGCCTCCGAGCTTCTCGGCGGAGCAATTGGCGCAAAATTTTGCCCGAAAGGGGTTGACCACGGAGGAGATGGTGGTGCTCTCCGGTGCCCACTCGATCGGTGTGGCCCACTGCT
CTTCATTCGCCAATCGGCTCTACTCATTCAATAGGACCCACCCGCAG
GTCGGACCCATTAATACGTATAGGTCGAGTCTGACAACTAAACACTTTATGGTTAATTGTGTACATATTTACT
CGCAGGATCCGACGTTGGACTCCACGTACGCGACAGAGCTAAAGAGGCGATGCCCGAATGACGGAGGAAATGCGGCGGCGGACCTTGACTCGACACCAAACCGTCTAGACAATCGATACT
TCGCTGATCTTAAGAGGCGGAGAGGGATTTTGAGCTCGGACCAGACACTTATGGATAGTACATTGACGAGGAATATAGCGATGAAGTTCGCTAGTGGGAACGGTGGCGCATGGGCCGGAA
GGTACGCCAAGGCCATGGTGAAGATGGGGTCGATTGAGGTCCTTACGGGGAATAATGGGGAGATTAGGAAAATTTGTAGTGTCGTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGAGGCTGCTCTGAAGCCAGGCTTCTACAAGTCATCGTGCCCATCGGCTGAATCCGTCGTCAAGAGGGTCGTGACCAGGGCCGTGTCTCGCGATTCAAACCTTGGAGCCGGACTC
ATTAGGATGCACTTCCACGACTGCTTTATCAGG
GGATGTGACGCATCGGTCCTCCTGAAATCCTCCCCGGGAGGGAACCAAACCGAGAGAGACCATCCGGCCAACAACCCGAGCCTAAGA
GGATTCGAGGTAATCGACTCGGCCAAATCGGAACTCGAATTAGTCTGCCCAAACACCGTCTCATGCGCCGACATTATCGCCTTTGCCGCTCGGGACAGCTCATTCATCCTCGGACGCATC
AACTACGGCGTCCCCGCCGGTCGTCGCGATGGCCGCGTTTCGTCTTCCGACGATATCGGCGCTAACCTCCCGCCTCCGAGCTTCTCGGCGGAGCAATTGGCGCAAAATTTTGCCCGAAAG
GGGTTGACCACGGAGGAGATGGTGGTGCTCTCCGGTGCCCACTCGATCGGTGTGGCCCACTGCTCTTCATTCGCCAATCGGCTCTACTCATTCAATAGGACCCACCCGCAG
GATCCGACG
TTGGACTCCACGTACGCGACAGAGCTAAAGAGGCGATGCCCGAATGACGGAGGAAATGCGGCGGCGGACCTTGACTCGACACCAAACCGTCTAGACAATCGATACTTCGCTGATCTTAAG
AGGCGGAGAGGGATTTTGAGCTCGGACCAGACACTTATGGATAGTACATTGACGAGGAATATAGCGATGAAGTTCGCTAGTGGGAACGGTGGCGCATGGGCCGGAAGGTACGCCAAGGCC
ATGGTGAAGATGGGGTCGATTGAGGTCCTTACGGGGAATAATGGGGAGATTAGGAAAATTTGTAGTGTCGTCAATTGA

Retrieve as FASTA