Entry information : LuPrx161 (Lus10029065|PACid:23151794)
Entry ID 12106
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-16 (Christophe Dunand)
Peroxidase information: LuPrx161 (Lus10029065|PACid:23151794)
Name (synonym) LuPrx161 (Lus10029065|PACid:23151794)
Class Class III peroxidase    [Orthogroup: Prx041]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx161
start..stop
S start..stop
LuPrx186 564 0 4..319 3..322
MePrx35 439 1e-156 10..319 8..316
MePrx123 417 4e-148 7..319 5..316
GhPrx25 416 4e-147 7..319 16..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 345678..345890 213 N° 2 345966..346157 192 N° 3 346236..346401 166 N° 4 346497..346738 242
N° 5 346847..346993 147  
join(345678..345890,345966..346157,346236..346401,346497..346738,346847..346993)


exon

Literature and cross-references LuPrx161 (Lus10029065|PACid:23151794)
DNA ref. Phytozome 12:   scaffold376 (345678..346993)
Protein sequence: LuPrx161 (Lus10029065|PACid:23151794)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (298)
PWM (Da):   %s   34648.3 (32565.2)  
PI (pH):   %s   4.93 (4.93) Peptide Signal:   %s   cut: 22 range:22-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPPNTTFCLILLLAVVGSAASSGSLSPEYYSKTCPEAPAIVKAVVGAALKNETRMGASLLRLHFHDCFVNGCDASILLDDNVTFVGEKTASPNINSTRGYEVIDKIKAQVEEECPGVVSCADILALAAVDSVVYLGGPWWEVGLGRRDSITASKEAAEVSLPQPTFNLSDLAANFWAHGLSLRDLVALSGAHTIGMARCTTFRDHIYNDTDIDPTFAKWLRKICPPIGHDDVLTPLDYQTPLRFDNSYYLNLVKERGLLHSDQELYDDDHAASIVRIYADHPAAFFEDFSKGMIKMGEIMPLTGDAGEIRKNCRKAN*

Retrieve as FASTA  
Remarks Complete sequence from genomic '3 introns and 1 extra in 3'). Incorrect prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCGAACACCACTTTCTGCCTCATTCTGTTACTTGCTGTTGTTGGTTCTGCAGCTTCCAGTGGCAGTCTCTCACCGGAGTATTACTCGAAGACCTGCCCCGAAGCACCGGCC
ATAGTCAAAGCAGTAGTCGGGGCAGCACTAAAGAACGAGACTCGAATGGGGGCGTCCCTCCTTCGCCTGCATTTCCATGACTGTTTTGTCAAC
GTGAGTAACGAATAACGAATAAAAACA
CATACTTTCTTCGCAATCTTTTTCTTTAATCGTGGATATTTTTGGTAGGGATGCGATGCCTCGATTCTGCTCGATGATAACGTGACATTCGTTGGGGAGAAAACTGCTTCTCCCAACATC
AACTCCACCAGAGGGTATGAAGTTATAGACAAGATCAAGGCTCAGGTGGAAGAAGAATGCCCTGGAGTTGTGTCTTGTGCTGATATACTTGCCTTGGCAGCCGTGGACTCTGTGGTTTAT
GTATGTTGTTCTTCCCTTTTTTCACGATCTGATCTTACATAAATCTCTGTATCGAATGAATGTTTCGGAAAATCGCAGCTTGGAGGACCTTGGTGGGAAGTTGGATTGGGAAGAAGGGAC
TCCATCACTGCAAGCAAAGAAGCTGCTGAAGTATCCTTACCTCAACCAACCTTCAATCTGAGTGATCTGGCTGCAAATTTTTGGGCACACGGCCTTTCTCTCCGGGACCTGGTTGCACTT
TCAG
GTGATCATGATCGAAAACTGGGGTGGAACTGTGATCATAGACTTAAATCGTATGAAGTATTGACTTAAACCGAAAGATTTTATTGATGAATGCAGGTGCACACACGATAGGAATGG
CGAGATGCACGACATTCCGAGACCACATCTACAACGACACCGACATCGACCCAACATTCGCAAAATGGCTGCGGAAGATCTGCCCTCCGATCGGACACGACGACGTCCTCACACCTCTTG
ATTACCAAACTCCCCTCCGTTTCGACAATTCCTACTACCTCAACTTGGTCAAGGAGAGAGGCCTCCTCCACTCGGACCAGGAGCTCTACGATGATGATAAT
GACGATGATGATTCCTCGG
CTCGTTCTGTTGCCAGAACACTGTACGAAACTCGACCTTCCAATGACTTCTTCAACAAGATAGCCAAGATCAGGCCGGTCACCGAAAACCACGCTGCTTCGATTGTTCGAATCTACGCCG
ATCATCCTGCGGCGTTCTTTGAGGATTTCAGTAAGGGCATGATCAAAATGGGGGAGATCATGCCTCTTACTGGAGATGCAGGGGAGATCAGGAAGAACTGCAGAAAAGCCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTCCGAACACCACTTTCTGCCTCATTCTGTTACTTGCTGTTGTTGGTTCTGCAGCTTCCAGTGGCAGTCTCTCACCGGAGTATTACTCGAAGACCTGCCCCGAAGCACCGGCC
ATAGTCAAAGCAGTAGTCGGGGCAGCACTAAAGAACGAGACTCGAATGGGGGCGTCCCTCCTTCGCCTGCATTTCCATGACTGTTTTGTCAAC
GGATGCGATGCCTCGATTCTGCTCGAT
GATAACGTGACATTCGTTGGGGAGAAAACTGCTTCTCCCAACATCAACTCCACCAGAGGGTATGAAGTTATAGACAAGATCAAGGCTCAGGTGGAAGAAGAATGCCCTGGAGTTGTGTCT
TGTGCTGATATACTTGCCTTGGCAGCCGTGGACTCTGTGGTTTAT
CTTGGAGGACCTTGGTGGGAAGTTGGATTGGGAAGAAGGGACTCCATCACTGCAAGCAAAGAAGCTGCTGAAGTA
TCCTTACCTCAACCAACCTTCAATCTGAGTGATCTGGCTGCAAATTTTTGGGCACACGGCCTTTCTCTCCGGGACCTGGTTGCACTTTCAG
GTGCACACACGATAGGAATGGCGAGATGC
ACGACATTCCGAGACCACATCTACAACGACACCGACATCGACCCAACATTCGCAAAATGGCTGCGGAAGATCTGCCCTCCGATCGGACACGACGACGTCCTCACACCTCTTGATTACCAA
ACTCCCCTCCGTTTCGACAATTCCTACTACCTCAACTTGGTCAAGGAGAGAGGCCTCCTCCACTCGGACCAGGAGCTCTACGATGATGATAAT
CACGCTGCTTCGATTGTTCGAATCTAC
GCCGATCATCCTGCGGCGTTCTTTGAGGATTTCAGTAAGGGCATGATCAAAATGGGGGAGATCATGCCTCTTACTGGAGATGCAGGGGAGATCAGGAAGAACTGCAGAAAAGCCAACTGA

Retrieve as FASTA