Entry information : LuPrx162(Lus10029094|PACid:23151751)
Entry ID 12107
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx162(Lus10029094|PACid:23151751)
Name LuPrx162(Lus10029094|PACid:23151751)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx162
start..stop
S start..stop
LuPrx74 650 0 1..330 1..330
MePrx12 486 1e-174 3..329 11..339
MePrx128 480 3e-172 27..329 37..341
CclPrx93 473 2e-169 7..329 12..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 483683..483898 216 N° 2 483382..483573 192 N° 3 483126..483291 166 N° 4 482607..483025 419
complement(join(482607..483025,483126..483291,483382..483573,483683..483898))


exon

Literature and cross-references LuPrx162(Lus10029094|PACid:23151751)
DNA ref. Phytozome 12:   scaffold376 (483898..482607)
Protein sequence: LuPrx162(Lus10029094|PACid:23151751)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (306)
PWM (Da):   %s   36330.06 (33558.5) Transmb domain:   %s   i2-24o
PI (pH):   %s   4.6 (4.49) Peptide Signal:   %s   cut: 25 range:25-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFSHVLFVVFIIFVASPSRLIAGELTLDYYSETCPTVFEVVRKEMECVVLSDPRNAAKVIRLHFHDCFVQGCDGSILLDDTLMLKGEKSATPNAKSLKGFEIIDSIKNKVESDCPGVVSCADILALAARDATVLVGGPDWEMYLGRKDSRTASYELAGSNLPLPTDGLLSIISKFIYQGLSVTDMVALSGSHTIGMARCESYRDRIYGDYEVTSDQSPASESHLKDLKATCPAAGGEDDTVSPMDYESPNLFDNSYFRILLRGEGLLNSDQELYSSILGIQTKQLVIQYAHDSVGFFEQFARSMVRMGNITNEVDAGEVRRNCRFVNI*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTTTTCAGCCACGTACTGTTCGTCGTGTTCATCATCTTCGTTGCGTCTCCCAGTAGATTGATTGCCGGAGAGCTAACTCTAGACTACTATTCAGAAACTTGCCCCACGGTATTC
GAGGTTGTCAGGAAAGAAATGGAATGTGTTGTGCTTTCTGATCCTCGTAATGCTGCTAAGGTTATCAGGCTCCACTTCCATGACTGTTTTGTCCAG
GTAATTGAACACATGAAGATTCAA
AAGTAACCAACGTTTCGAATCATTAATAACATCATAAAGATTCAATCTTTTATGTAATGTGGCGGTGGTATTAATTTGGTTGCAGGGATGTGACGGGTCGATTTTGCTAGACGATACACT
GATGCTGAAAGGGGAAAAATCAGCCACCCCAAATGCGAAATCACTCAAAGGGTTCGAGATTATTGATAGTATTAAGAACAAAGTCGAATCCGATTGCCCCGGTGTTGTTTCTTGTGCTGA
TATCCTTGCACTTGCTGCTAGAGATGCTACAGTTCTG
GTATACCATGAATCCATGATCACTTCTTTTTTAACGTATCATTTCTATATCATCCACATTTTACAATTTAATTCTGTGATCAA
TTGGTAGGTTGGTGGACCTGATTGGGAGATGTATTTAGGAAGAAAAGATTCAAGAACTGCGAGCTACGAGCTCGCCGGTTCAAATCTCCCACTTCCAACCGACGGTCTCTTGTCGATCAT
ATCAAAGTTCATTTACCAGGGACTCTCTGTTACAGACATGGTTGCTCTCTCAG
GTAAAAAAAAATTTCACTGCTTCATTTTACATAATAAAACAGTTAAAACAGTTAGTTTCACCGGTTC
AATCAGTTTTTATAAAAAAAACGCCATGTGCAGGATCCCACACGATAGGCATGGCTCGGTGCGAGAGCTACAGGGATAGGATCTATGGGGACTACGAGGTGACATCGGACCAGTCCCCGG
CCTCGGAGTCCCACCTCAAAGATCTGAAGGCCACGTGTCCGGCTGCAGGAGGGGAAGACGACACTGTCTCCCCCATGGACTACGAGAGTCCGAACCTGTTCGACAATTCTTACTTCCGCA
TTTTGTTGAGGGGAGAGGGACTCCTTAATTCCGACCAGGAGCTCTACTCGAGTATCCTCGGGATCCAGACGAAGCAGCTGGTGATCCAATACGCTCACGACTCGGTCGGTTTTTTCGAGC
AGTTCGCCCGGTCGATGGTCAGGATGGGGAACATTACTAATGAGGTTGATGCCGGGGAGGTCAGGAGGAACTGCAGATTTGTTAACATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTTTTCAGCCACGTACTGTTCGTCGTGTTCATCATCTTCGTTGCGTCTCCCAGTAGATTGATTGCCGGAGAGCTAACTCTAGACTACTATTCAGAAACTTGCCCCACGGTATTC
GAGGTTGTCAGGAAAGAAATGGAATGTGTTGTGCTTTCTGATCCTCGTAATGCTGCTAAGGTTATCAGGCTCCACTTCCATGACTGTTTTGTCCAG
GGATGTGACGGGTCGATTTTGCTA
GACGATACACTGATGCTGAAAGGGGAAAAATCAGCCACCCCAAATGCGAAATCACTCAAAGGGTTCGAGATTATTGATAGTATTAAGAACAAAGTCGAATCCGATTGCCCCGGTGTTGTT
TCTTGTGCTGATATCCTTGCACTTGCTGCTAGAGATGCTACAGTTCTG
GTTGGTGGACCTGATTGGGAGATGTATTTAGGAAGAAAAGATTCAAGAACTGCGAGCTACGAGCTCGCCGGT
TCAAATCTCCCACTTCCAACCGACGGTCTCTTGTCGATCATATCAAAGTTCATTTACCAGGGACTCTCTGTTACAGACATGGTTGCTCTCTCAG
GATCCCACACGATAGGCATGGCTCGG
TGCGAGAGCTACAGGGATAGGATCTATGGGGACTACGAGGTGACATCGGACCAGTCCCCGGCCTCGGAGTCCCACCTCAAAGATCTGAAGGCCACGTGTCCGGCTGCAGGAGGGGAAGAC
GACACTGTCTCCCCCATGGACTACGAGAGTCCGAACCTGTTCGACAATTCTTACTTCCGCATTTTGTTGAGGGGAGAGGGACTCCTTAATTCCGACCAGGAGCTCTACTCGAGTATCCTC
GGGATCCAGACGAAGCAGCTGGTGATCCAATACGCTCACGACTCGGTCGGTTTTTTCGAGCAGTTCGCCCGGTCGATGGTCAGGATGGGGAACATTACTAATGAGGTTGATGCCGGGGAG
GTCAGGAGGAACTGCAGATTTGTTAACATTTGA

Retrieve as FASTA