Entry information : LuPrx164(Lus10029543|PACid:23149412)
Entry ID 12109
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx164(Lus10029543|PACid:23149412)
Name LuPrx164(Lus10029543|PACid:23149412)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx164
start..stop
S start..stop
MePrx119 511 0 12..327 12..318
RcPrx53 510 0 31..327 20..315
GrPrx39 503 0 12..327 14..323
GhPrx39 503 0 12..327 14..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 898857..899291 435 N° 2 899376..899538 163 N° 3 900377..900762 386  
join(898857..899291,899376..899538,900377..900762)


exon

Literature and cross-references LuPrx164(Lus10029543|PACid:23149412)
DNA ref. Phytozome 12:   scaffold55 (898857..900762)
Protein sequence: LuPrx164(Lus10029543|PACid:23149412)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (303)
PWM (Da):   %s   35646.58 (33089.2)  
PI (pH):   %s   7.24 (6.74) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAKLGAKETILLVLVTMVVMSSAGFNFRPRFGADGLSMQYYVMNCPIADQIVKGTVNAALQADPTLAAALVRMHFHDCFIQGCDASILLDSTKDNAAEKDSPANLSLRGYEVIDDAKDKLEEQCPGVVSCADIVAMAARDAVFFAGGPVYEIPKGRKDGKRSKIEDTINLPFPTMNASELIRTFGQRGFSAQEMVALSGAHTLGVSRCSSFKNRLSNPDPTMIDSTFAQSLSKTCTAGGDSAEQPFDMTRNSFDNLYFNTLTKKSGLLFSDQTLYSNPKTRTVVNGYSFNQAMFFLDFQQAMVKMGNLDVKQGSQGEVRQNCRRIN*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCGAAACTGGGCGCCAAAGAGACGATCCTGCTGGTCCTTGTGACGATGGTGGTGATGAGCAGCGCAGGGTTCAACTTCAGACCACGGTTCGGAGCCGACGGACTAAGCATGCAG
TACTACGTCATGAACTGCCCCATCGCTGACCAGATAGTCAAGGGGACAGTCAACGCCGCACTCCAGGCCGACCCCACCTTGGCGGCAGCACTTGTTAGGATGCACTTCCACGACTGCTTC
ATCCAAGGCTGCGACGCCTCCATTCTCCTAGACTCCACAAAGGACAACGCCGCGGAGAAAGATTCTCCGGCCAACCTCAGCTTGAGAGGCTACGAGGTCATTGATGATGCCAAGGATAAG
CTTGAAGAGCAGTGCCCCGGTGTTGTCTCCTGCGCCGACATCGTTGCCATGGCTGCCAGAGATGCTGTTTTCTTC
GTTAGTATACTATAACTTTTTTCTCTTGATCTATATATATATTTT
TGGTTTTTGGATGAGTTAATAAAAGTGTTATTAATATAGGCTGGAGGGCCGGTGTATGAAATACCGAAGGGAAGAAAGGACGGGAAGAGGTCGAAAATAGAGGACACGATCAATTTACCA
TTCCCGACTATGAATGCTTCGGAGCTCATCCGTACTTTTGGACAGCGTGGTTTCTCTGCCCAAGAGATGGTCGCCCTCTCCG
GTAATTACACTCTCGTACCTACTTAACTTCAAAATTAC
GCTTCAACGACAAAATTGCAAAGTAGTTAGGCTGTAAATTTTCGCTGGAATTTCTAAAATTCTCAGAATTCGGATTTGCATAAATACAGATCTTTACAATTGAAATTCAGAGGGTGAAAT
TAGGTGAAATTAAGCCTTTAAATGTCACAAGTTTGAGGATGTGGATTTGTGACTGTAGAAAATATATCCGTCGGACTTTGTTGGGCATTCGATAAATATATCTGCGGGAATCCTTGAGTA
ATATTTAATAAAAAATAGGTAAATCGGTCGATGTAGAGAATAACCGATCACATTAATTTGGTCGCTTAACTAAAATTTGATAATGAAAATAGGTTAATTGATTAACCAACTGGTAATGAT
GATTTGTTAATGAACTGTTAATTAATCGACTAAAATAGATCGGTTAAAATCAGTTTAGATTAAAATATGTATAAATATGAAGAGAATCCATTAAATTTTTATTTTAATTAAAAAACTTCT
CAAATCCTTAACCGCTCTAAAAACTTCACTTCGTCCAATTCTATCCAAAACCGCAAAGGAATGATGTCTAGAAGTCAAACTCGATCAATAGTATTTGGTCTGATTTATTTATAAAATTCT
CATTGTGATTTATACACTAATTTATTCTTTTCTTTCTGGAGATCGATAAAGTATATATTATCAATATTATATCCATAAAAATACAATTCAATTACAAAAATCAATAAAAAAAATATTTTT
GTCATCACATATAATTGTTAGTGTAGTGGTAATGAAAAAGGGAAGTAATTTTGGTGGTGGTGGGTGAACGCATGCTGCAGGAGCGCACACACTAGGGGTGTCAAGGTGCTCGTCCTTCAA
AAACCGTCTGAGCAACCCGGATCCCACCATGATTGACTCCACCTTCGCCCAGTCCCTTTCCAAGACTTGCACCGCCGGCGGGGACTCCGCCGAGCAGCCTTTCGACATGACCAGAAACAG
CTTCGACAACCTCTACTTCAATACTCTCACCAAGAAATCTGGGCTGCTCTTCTCCGACCAAACCTTGTACTCCAACCCCAAGACCAGGACCGTCGTCAACGGCTACTCCTTCAACCAGGC
CATGTTCTTTCTCGACTTCCAGCAGGCCATGGTAAAGATGGGTAACCTTGACGTTAAGCAAGGCTCTCAGGGCGAAGTTCGCCAGAATTGCCGCAGGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCGAAACTGGGCGCCAAAGAGACGATCCTGCTGGTCCTTGTGACGATGGTGGTGATGAGCAGCGCAGGGTTCAACTTCAGACCACGGTTCGGAGCCGACGGACTAAGCATGCAG
TACTACGTCATGAACTGCCCCATCGCTGACCAGATAGTCAAGGGGACAGTCAACGCCGCACTCCAGGCCGACCCCACCTTGGCGGCAGCACTTGTTAGGATGCACTTCCACGACTGCTTC
ATCCAAGGCTGCGACGCCTCCATTCTCCTAGACTCCACAAAGGACAACGCCGCGGAGAAAGATTCTCCGGCCAACCTCAGCTTGAGAGGCTACGAGGTCATTGATGATGCCAAGGATAAG
CTTGAAGAGCAGTGCCCCGGTGTTGTCTCCTGCGCCGACATCGTTGCCATGGCTGCCAGAGATGCTGTTTTCTTC
GCTGGAGGGCCGGTGTATGAAATACCGAAGGGAAGAAAGGACGGG
AAGAGGTCGAAAATAGAGGACACGATCAATTTACCATTCCCGACTATGAATGCTTCGGAGCTCATCCGTACTTTTGGACAGCGTGGTTTCTCTGCCCAAGAGATGGTCGCCCTCTCCG
GA
GCGCACACACTAGGGGTGTCAAGGTGCTCGTCCTTCAAAAACCGTCTGAGCAACCCGGATCCCACCATGATTGACTCCACCTTCGCCCAGTCCCTTTCCAAGACTTGCACCGCCGGCGGG
GACTCCGCCGAGCAGCCTTTCGACATGACCAGAAACAGCTTCGACAACCTCTACTTCAATACTCTCACCAAGAAATCTGGGCTGCTCTTCTCCGACCAAACCTTGTACTCCAACCCCAAG
ACCAGGACCGTCGTCAACGGCTACTCCTTCAACCAGGCCATGTTCTTTCTCGACTTCCAGCAGGCCATGGTAAAGATGGGTAACCTTGACGTTAAGCAAGGCTCTCAGGGCGAAGTTCGC
CAGAATTGCCGCAGGATTAATTAA

Retrieve as FASTA