Entry information : LuPrx168(Lus10030145|PACid:23172575)
Entry ID 12110
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx168(Lus10030145|PACid:23172575)
Name LuPrx168(Lus10030145|PACid:23172575)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx168
start..stop
S start..stop
LuPrx64 634 0 1..321 1..321
LuPrx49 437 5e-156 23..321 7..307
GmPrx70 437 1e-155 16..321 19..325
PpePrx43 437 1e-155 1..321 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1185554..1185763 210 N° 2 1185253..1185447 195 N° 3 1184137..1184697 561  
complement(join(1184137..1184697,1185253..1185447,1185554..1185763))


exon

Literature and cross-references LuPrx168(Lus10030145|PACid:23172575)
DNA ref. Phytozome 12:   scaffold19 (1185763..1184137)
Protein sequence: LuPrx168(Lus10030145|PACid:23172575)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (298)
PWM (Da):   %s   34463.25 (31994.9)  
PI (pH):   %s   7.36 (6.98) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGSKAFLTLAVSAFFLIQSISAQLTSNFYETICPEALPTIKRVVNKAIRDEPRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTAAPNLNSVRGFDVVDEIKSAVDKACKGSVVSCADILAVAARDSVSFLGGPQFWYQVLVGRRDAKTASISAANNNLPPPFYSFSQLISSFQAQGLDLTDLVALSGGHTIGLARCTTFRAHIYNDTNIQPRLAASLQRSCPPTGGDNNLKPLDSTPAQFNTDYYSDLVRNRGLLHSDQELFGTGNSASDKLVMTYSSNPTKFAADFATSMVKMGNLQVVTGSAGEVRNNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction. Extra ps.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGGTTCCAAAGCTTTCCTCACGCTTGCAGTATCAGCTTTCTTCCTGATCCAATCTATTTCTGCACAACTAACATCAAACTTTTACGAAACTATTTGTCCCGAAGCGTTGCCCACT
ATAAAAAGGGTAGTGAACAAGGCCATCAGAGATGAACCTCGTATGGGTGCATCACTGCTTCGTCTCCACTTCCATGACTGCTTCGTCAAT
GTACGTATGCACTGGTTTCCTTATTAGTTT
GTCTTGTGTTTTTTTTTCTATATGACGAGTTATAATTATAATATAATATTGTGAGATATGAAATTCATTCATTCAGGGATGCGACGGGTCAATTCTTTTGGACGATACATCAAGCTTTAC
TGGGGAGAAAACTGCTGCCCCGAACCTGAACTCGGTTAGAGGGTTTGATGTCGTTGACGAAATCAAGTCCGCAGTTGACAAAGCATGCAAAGGCAGCGTCGTCTCTTGCGCCGACATCTT
AGCTGTCGCTGCTCGCGATTCGGTCTCTTTT
GTAAGCATCCCAACTCAACACCCCCTCAATCATACTAATATACCATAAAAAAAAGATATATAGAAAAGTCAACTGATCTCAACGGCATA
GAAAGTCTTTAGTACTGAATATTTTTACAAGAAATGAATATTAGTTTAATGGACACTATTTACAACGAATCATGATAAGATTATCGTTGGTTAATTGAAGTTGTTTTGTATATACATGCA
ATTGAATAAATTTTTAGACTAAGTCATCTGTGTGACAGAAATGATAATAGTTTATGTAGGTAAGAAGAAAATATTAATTTCGATTTTGTGATCAAACTATGCCTATGCATAAAGTGGAAT
GTTTTTAACCGGCAGAGGATGTTCGGTCGGTTCGACCCAACCCCAACCAACAAAGTGGCTCCACCACAGATGGAAACAGTAACCTTCATTCTCTAAAATCACTATCGGGATCTAACATCC
TGTTGTCTGAGTAAAATAATATTTAAAATTCGATCCAACTTTCACTACAAAAATCGAGCCACAGTCATTTGTTTTAATTACTTTGAATGTTAATCATGTTATATAGTTGGGTGGCCCACA
ATTCTGGTACCAAGTCCTAGTAGGAAGAAGAGACGCCAAGACAGCCAGCATCTCCGCCGCAAACAACAACCTCCCACCGCCGTTCTATAGCTTCTCACAACTCATCTCCAGCTTCCAAGC
CCAAGGCCTCGACCTCACCGACCTAGTCGCGCTCTCCGGAGGCCATACCATCGGGCTAGCTCGCTGCACCACTTTTCGCGCCCACATCTACAACGACACCAACATCCAACCTAGATTGGC
CGCTTCCTTACAGAGGTCCTGCCCTCCTACCGGTGGCGACAACAACCTCAAGCCGCTTGATTCGACTCCGGCCCAGTTCAATACCGACTACTACAGTGATCTTGTCCGGAACAGAGGCCT
TCTACACTCCGACCAGGAACTGTTTGGAACTGGGAACAGTGCCAGCGACAAGCTTGTGATGACCTACAGTAGTAATCCGACGAAGTTCGCGGCGGATTTTGCGACGTCGATGGTCAAGAT
GGGAAATCTTCAGGTTGTTACTGGGAGTGCTGGAGAGGTCAGGAACAACTGTCGCGTCGTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGGTTCCAAAGCTTTCCTCACGCTTGCAGTATCAGCTTTCTTCCTGATCCAATCTATTTCTGCACAACTAACATCAAACTTTTACGAAACTATTTGTCCCGAAGCGTTGCCCACT
ATAAAAAGGGTAGTGAACAAGGCCATCAGAGATGAACCTCGTATGGGTGCATCACTGCTTCGTCTCCACTTCCATGACTGCTTCGTCAAT
GGATGCGACGGGTCAATTCTTTTGGACGAT
ACATCAAGCTTTACTGGGGAGAAAACTGCTGCCCCGAACCTGAACTCGGTTAGAGGGTTTGATGTCGTTGACGAAATCAAGTCCGCAGTTGACAAAGCATGCAAAGGCAGCGTCGTCTCT
TGCGCCGACATCTTAGCTGTCGCTGCTCGCGATTCGGTCTCTTTT
TTGGGTGGCCCACAATTCTGGTACCAAGTCCTAGTAGGAAGAAGAGACGCCAAGACAGCCAGCATCTCCGCCGCA
AACAACAACCTCCCACCGCCGTTCTATAGCTTCTCACAACTCATCTCCAGCTTCCAAGCCCAAGGCCTCGACCTCACCGACCTAGTCGCGCTCTCCGGAGGCCATACCATCGGGCTAGCT
CGCTGCACCACTTTTCGCGCCCACATCTACAACGACACCAACATCCAACCTAGATTGGCCGCTTCCTTACAGAGGTCCTGCCCTCCTACCGGTGGCGACAACAACCTCAAGCCGCTTGAT
TCGACTCCGGCCCAGTTCAATACCGACTACTACAGTGATCTTGTCCGGAACAGAGGCCTTCTACACTCCGACCAGGAACTGTTTGGAACTGGGAACAGTGCCAGCGACAAGCTTGTGATG
ACCTACAGTAGTAATCCGACGAAGTTCGCGGCGGATTTTGCGACGTCGATGGTCAAGATGGGAAATCTTCAGGTTGTTACTGGGAGTGCTGGAGAGGTCAGGAACAACTGTCGCGTCGTT
AATTGA

Retrieve as FASTA