Entry information : LuPrx170 (Lus10030148|PACid:23172612)
Entry ID 12112
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-01-16 (Christophe Dunand)
Peroxidase information: LuPrx170 (Lus10030148|PACid:23172612)
Name (synonym) LuPrx170 (Lus10030148|PACid:23172612)
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx170
start..stop
S start..stop
LuPrx61 572 0 1..284 46..329
LuPrx62 486 4.73e-176 1..240 48..287
LuPrx171 464 4.7e-167 1..283 45..327
MePrx83 456 1.32e-163 1..283 34..316
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12112' 'join(1213471..1213569,1213835..1214026,1214143..1214311,1214397..1214788)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1213471..1213569 97 N° 2 1213835..1214026 190 N° 3 1214143..1214311 167 N° 4 1214397..1214788 390
join(1213471..1213569,1213835..1214026,1214143..1214311,1214397..1214788)


exon

Literature and cross-references LuPrx170 (Lus10030148|PACid:23172612)
DNA ref. Phytozome 12:   scaffold19 (1213471..1214788)
Protein sequence: LuPrx170 (Lus10030148|PACid:23172612)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   283 (696)
PWM (Da):   %s   30388.7 (78750.3)  
PI (pH):   %s   10.53 (9.03) Peptide Signal:   %s   cut: 39 range:39-734
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTVRSAVQSAVSKETRVAASLIRLHFHDCFVNGCDGSILLEDTASFTGEQTALPNAGSVRGFNVIKDIKSKVEKVCPGVVSCADILAIAARDSTAIAGGKSWKVRLGRRDSKTASLAAA
NSGVIPPPTATLNQLITRFQARGLSAKDMVVLSGSHTIGQARCVTFRNRIYNETNIDSSFARGRQQKCPRAQNSGNNNLAPFDVTTPKLLDNKYYQNLIQQKGLLHSDQVLFNGGSTDSL
VRSYSRNPKAFAADFASAMIKMGSISPLTGSQGEIRKICSRPN*

Retrieve as FASTA  
Remarks Partial sequence from genomic (3 introns). Incorrect prediction from Phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACAGTGAGATCCGCCGTGCAATCCGCCGTCTCCAAGGAAACAAGGGTGGCTGCCTCTCTTATCCGCTTGCATTTCCACGATTGTTTCGTCAACACGTAAGTAATTACTCTCTTT
AATTATATAGCTTAGGAAAATGTGGTTTTGTTTCATAGTGAGACAAAATTGATCACAGTCACACTACCAATAAATTAGGGGCCCATTGTTTTTACTGTGTCAAAATTAAACGAATCCTCA
TGAGCCCCCAATTTATTGGTATTGAGACAGTTCATTTTCTTTCTGTGTGAGTCAAAAAATTCCCCCCCTAGCTTAATACTATATGTTAAATTCATTGATCGAGTTTTCCGGTGTTGGAAA
AAACAGGGTTGTGATGGATCGATATTACTGGAAGACACAGCTTCGTTCACAGGAGAACAAACTGCTCTGCCCAATGCCGGATCAGTGAGAGGATTTAACGTAATCAAAGACATAAAGTCC
AAGGTTGAGAAAGTCTGCCCAGGCGTCGTCTCCTGTGCCGACATCCTAGCCATCGCTGCTCGAGATTCCACCGCCATT
TTGTACAATCGAACACCACTCCATGTTAAAATGAAATATCTT
ATCTACCATCCATTTTGATCTCTTGATCAATTAATTGATTCTCGTGCATGGGTGGATTATACTTAATTACTTGCAGGCAGGGGGCAAAAGTTGGAAGGTGAGGCTTGGAAGGAGGGATTC
CAAAACAGCTAGTTTGGCTGCAGCAAACAGTGGAGTTATCCCTCCCCCTACCGCCACTCTTAACCAACTCATCACTCGCTTCCAAGCCAGAGGCCTCTCCGCTAAGGACATGGTCGTTCT
CTCCG
CGGTAATTAAGCAGCGGTAGATCCACAAGGTATTGGACCGACTTGTATAGATATGTTAAATTCATTTCAAATTAATTTTGGCTGCAGGATCCCACACGATTGGACAAGCTAGGTG
CGTAACATTCAGGAACAGAATCTACAACGAGACCAACATCGACTCTTCGTTTGCAAGAGGCCGACAGCAGAAGTGCCCCAGGGCTCAAAACTCAGGGAACAACAATTTGGCCCCATTTGA
CGTTACGACTCCCAAGTTGTTAGACAACAAGTACTACCAGAACCTCATCCAGCAAAAGGGTCTTCTCCACTCTGACCAAGTCTTGTTCAACGGTGGATCGACTGATTCCCTTGTACGATC
CTACAGTCGTAATCCAAAGGCCTTCGCCGCGGACTTTGCATCTGCGATGATCAAGATGGGAAGCATAAGTCCCCTCACTGGTTCTCAAGGCGAGATCAGGAAGATATGTAGCAGGCCTAA
CTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACAGTGAGATCCGCCGTGCAATCCGCCGTCTCCAAGGAAACAAGGGTGGCTGCCTCTCTTATCCGCTTGCATTTCCACGATTGTTTCGTCAACGGTTGTGATGGATCGATATTA
CTGGAAGACACAGCTTCGTTCACAGGAGAACAAACTGCTCTGCCCAATGCCGGATCAGTGAGAGGATTTAACGTAATCAAAGACATAAAGTCCAAGGTTGAGAAAGTCTGCCCAGGCGTC
GTCTCCTGTGCCGACATCCTAGCCATCGCTGCTCGAGATTCCACCGCCATT
GCAGGGGGCAAAAGTTGGAAGGTGAGGCTTGGAAGGAGGGATTCCAAAACAGCTAGTTTGGCTGCAGCA
AACAGTGGAGTTATCCCTCCCCCTACCGCCACTCTTAACCAACTCATCACTCGCTTCCAAGCCAGAGGCCTCTCCGCTAAGGACATGGTCGTTCTCTCCG
GATCCCACACGATTGGACAA
GCTAGGTGCGTAACATTCAGGAACAGAATCTACAACGAGACCAACATCGACTCTTCGTTTGCAAGAGGCCGACAGCAGAAGTGCCCCAGGGCTCAAAACTCAGGGAACAACAATTTGGCC
CCATTTGACGTTACGACTCCCAAGTTGTTAGACAACAAGTACTACCAGAACCTCATCCAGCAAAAGGGTCTTCTCCACTCTGACCAAGTCTTGTTCAACGGTGGATCGACTGATTCCCTT
GTACGATCCTACAGTCGTAATCCAAAGGCCTTCGCCGCGGACTTTGCATCTGCGATGATCAAGATGGGAAGCATAAGTCCCCTCACTGGTTCTCAAGGCGAGATCAGGAAGATATGTAGC
AGGCCTAACTAA

Retrieve as FASTA