Entry information : LuPrx171 ( Lus10030149|PACid:23172538)
Entry ID 12113
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2016-01-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-16 (Achraf Jemmat)
Peroxidase information: LuPrx171 ( Lus10030149|PACid:23172538)
Name (synonym) LuPrx171 ( Lus10030149|PACid:23172538)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx171
start..stop
S start..stop
LuPrx02 599 0 3..327 2..325
LuPrx61 517 0 3..327 1..328
MePrx83 471 6.44e-169 13..327 3..316
LuPrx170 464 5.41e-167 45..327 1..283
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12113' 'join(1225163..1225393,1225757..1225948,1226029..1226197,1226784..1226893,1228231..1228511)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1225163..1225393 229 N° 2 1225757..1225948 190 N° 3 1226029..1226197 167 N° 4 1226784..1226893 108
N° 5 1228231..1228511 279  
join(1225163..1225393,1225757..1225948,1226029..1226197,1226784..1226893,1228231 ..1228511)


exon

Literature and cross-references LuPrx171 ( Lus10030149|PACid:23172538)
DNA ref. Phytozome 12:   scaffold19 (1225163..1228511)
Protein sequence: LuPrx171 ( Lus10030149|PACid:23172538)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (297)
PWM (Da):   %s   35052.36 (31989.8)  
PI (pH):   %s   5.73 (5.16) Peptide Signal:   %s   cut: 31 range:31-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAGNSTIWVRSCLVVALLAVFGTGKCWGQLSTNFYSESCPMLMDTVRCEVESAVNKETRIAASLLRLHFHDCFVNGCDGSILLEDTNSFTGEQIAAPNNGSVRGYNVIEDIKSKVEQV
CPGVVSCADILAIAARDSTVIAGGQSWEVKVGRRDSKTASFNAANSGALPGPTSSLNELINTFKDQGLSAKDMVVLSGSHTIGVARYVLFRDRIYNETNIDPSFASERQDNCPLAPNSGD
DNLAPLDLKTPKSFDNNYYNNLIQQKGLLHSDQVLFNGGSTDSLVRSYSQRPKAFTADLAAAMVKMGDIKPLTGSQGEIRNVCSRPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns and 1 extra 3'). Incorrect prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCCGGTAATTCAACTATTTGGGTACGTTCATGTTTGGTGGTGGCTTTGCTTGCGGTGTTTGGTACTGGGAAATGTTGGGGTCAGCTCTCCACAAACTTCTATTCAGAGAGC
TGCCCTATGCTGATGGACACAGTGAGGTGCGAAGTCGAATCCGCTGTCAACAAGGAAACAAGGATTGCTGCCTCTCTCCTTCGCTTGCACTTTCATGACTGTTTCGTCAAC
ACGTAATTA
TCGATGTTTCTCTGTCTCTCTCTATATTTTATGAAAATCAGCTTTCATAACATAAATATAAATTTGTTTTTGTAATATAGTAGTAGACTAGTAGTGCAAACTAGACACTATAACTAGTCA
AATCCATGCCAGTTAAAAAACAATTAAAGTGAGAGAGGCTTGAACTCTCAACCCCAGGATCACTCAGCTATGAGACCTAGACATTAGCCAATTGCACCACCACCCCTTATTGTGAAAATT
ATAACAGTTTTAGAATTGACCTTCTATGCTCTGTATGATTACAGTTTGACACTAACCACTCGATCGGCAATAATTATTATCTGCAACTTTTATTTTTTTTTACTAGTCTGAAACAGGGTT
GTGATGGGTCGATACTGTTGGAAGACACGAATTCGTTCACAGGAGAACAGATTGCTGCACCAAACAACGGGTCCGTGAGAGGATATAACGTCATTGAAGACATTAAGTCGAAAGTTGAGC
AAGTATGTCCTGGAGTAGTCTCCTGCGCAGACATCCTCGCCATCGCTGCTCGAGATTCCACCGTCATC
TCGTAAGTAACCAATATATGCATCTTGTTCATACGTTACTTGTATTTTGATG
CTATTGTTATGGATGGATGCATTACTGCAGGCAGGAGGGCAAAGCTGGGAAGTGAAAGTTGGAAGGAGGGATTCAAAGACGGCCAGTTTTAATGCAGCAAATAGTGGAGCGCTCCCTGGC
CCTACATCTTCACTTAACGAGCTCATCAACACGTTCAAAGACCAAGGCCTCTCCGCCAAGGACATGGTGGTTCTATCCG
CGGTACGTACGCTTTCAATCTTCCAGTTCATTTCACAGCGC
GAATTTGAAACTTCATTAGGTATCGGTTTTTGGACAAAAATTGGAGTCACATCCAATCCTGCATGCAAGACAAAAATAATTGCGGCGTCCAAGTCCGCGAGAATTGGAGTCCAATCCCAA
CTAATTTTGGCTTGCCAATTCTGTTCCGACCGGGACAAAATTACCGATTATTACCCATTTCAGATTAAATTTGAATTTTCGTGGAATTGAACCAACCAAAAATATGGAAAACAGTTGGTT
TATAGTTATAGCTTCTTACCATGCACTAAAGGAACATGGACTTATGTATAATACAAAGCATTGCAGGGTTTAGATTACTCTCTTAATTTTAAATTTCATATATTATATTTTACTTCCCTC
TGTTGAATTTGTTGACTTAACTTAATTAAGAACAATAATACACTTAATTAATTTCCTAACTTCAACCAACAAACCAATATCATAATTTAATGACTTCATTTTCCATTACTTCTTTTCTAA
GTATGTTGTAAATAGTTTGATAATAAATAATTCATATCTCTATGCCCCTGAATGATGATGAATATAGGATCCCACACCATCGGAGTAGCGAGGTACGTTTTGTTTAGAGACCGAATCTAC
AACGAGACCAACATTGACCCTTCATTCGCAAGCGAAAGGCAAGACAATTGCCCCTTA
TAGCACTGATCGCCCGAATAACTACGAAGTTATTCCGACAACACAAGTGTCGTTTGTGTCCGA
AGGTCCCTCTCGTTATGCTTCTACTCGAATTCGTCAACACGGTTTAGGCTAAAAGATTTGGTTTTTGATGCTAATTATTCTAATGACTAAATTAAACTAAAAGACTTTAAGTTGATTCAA
AGGAGAAAGCGAGTTCTTGGAAGAGACGAGTCACTAAGCTCGACCGCTAGAATGCTTTCAAAACGAACAAATGTGGACCTGAATGGAATGAAAAGAATCCTACTAACACTCGTATGATTC
CGCGGCACGATTATGCACGCGGATTTCCACTACTAGCTTCCCAACTGAGGTAGAAATTCCCTTAATCGGGCTAACTAGTAATGAACTCCAAGGAGTTCTACAAAGTGAAAGGGTGCTTTA
CCGGAATCAAAAGAACCCATGAGTAATTGGAAATAGCGTTAACTTGGTCCATCAACGCCTAAGCTACTGATAACTACACCCAACTTGGTCCATTGGGTGCAAACCAGAGCGCCCGCCAAT
TACAACATGGCTTTCACTTAAAACCGAGAAAAACACAAAAGGTAGAATTAGGTTATCGGTTTACCCCACCAATAACCTAATTCTATCCTCGATTGCCAACCTACTGAATTCCTAAGCCTA
TCAAAAGCAAAGGATTTCATGAATTTGACCTAATTCTAGCCACAACAAGAATTAGGTTGAACACCAAACAATCGAGACAAACTTTCATTGCAATTCAAACATCCACAAACGTCGATCTTA
CACATTCAAGACAGGTTTCATAGCTTAATTCCTACATCTCATCCAAGAATCCCAAAGGATTTAGCTACTCATCATTCTAGAAGAAAGCAATGCAAAAGAAAACCTAACCATCTTCTTGCA
AAGAGATAACGGCTTGTTTTCCTTCCAATCGATGCTCTTGATCTTCTATGAGGAACGCCGTGCAAGGGTGCACGACGTTCCCCTGCTTAAGGGTCGTGATTTGGAAGCATCCTAGAGGTG
CACGGCGTGCATAGGTGCACGGCGTGCAACCCCTCTGCTCATCCATTTCATTTCTCAATCTTCCATTCGAGCTCCAACCGTGCTCTACTTCACGTTCATTGCTTCATAACAAGACCACCT
ATCTCTAGAGTACCTGTGGACAACAAATACTACAAAGAAACACATCAAATGGACCGAAACGGTCCAAATGAACGGGTCTAGGCACATAATGCCAAAACACGAAAGCACACAAGAATGAAG
CTCGAACAAACTAATAATCACTCAAAAAGCATGCATATAAGGATAGATAATTGCTAAAAATTCTAGTCTTATCAAGCACCTAACTCAGGCGACGACAACCTGGCCCCACTGGACCTCAAA
ACGCCGAAGTCTTTCGACAACAACTACTACAACAACCTCATCCAGCAAAAGGGTCTTCTCCACTCCGACCAAGTCCTGTTCAACGGAGGATCAACCGATTCCCTTGTACGATCCTATAGC
CAGAGACCGAAGGCATTCACTGCAGACTTGGCCGCGGCCATGGTTAAGATGGGAGATATCAAGCCCTTAACTGGGTCTCAGGGAGAGATCAGGAACGTATGTAGCAGACCTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCCGGTAATTCAACTATTTGGGTACGTTCATGTTTGGTGGTGGCTTTGCTTGCGGTGTTTGGTACTGGGAAATGTTGGGGTCAGCTCTCCACAAACTTCTATTCAGAGAGC
TGCCCTATGCTGATGGACACAGTGAGGTGCGAAGTCGAATCCGCTGTCAACAAGGAAACAAGGATTGCTGCCTCTCTCCTTCGCTTGCACTTTCATGACTGTTTCGTCAAC
GGTTGTGAT
GGGTCGATACTGTTGGAAGACACGAATTCGTTCACAGGAGAACAGATTGCTGCACCAAACAACGGGTCCGTGAGAGGATATAACGTCATTGAAGACATTAAGTCGAAAGTTGAGCAAGTA
TGTCCTGGAGTAGTCTCCTGCGCAGACATCCTCGCCATCGCTGCTCGAGATTCCACCGTCATC
GCAGGAGGGCAAAGCTGGGAAGTGAAAGTTGGAAGGAGGGATTCAAAGACGGCCAGT
TTTAATGCAGCAAATAGTGGAGCGCTCCCTGGCCCTACATCTTCACTTAACGAGCTCATCAACACGTTCAAAGACCAAGGCCTCTCCGCCAAGGACATGGTGGTTCTATCCG
GATCCCAC
ACCATCGGAGTAGCGAGGTACGTTTTGTTTAGAGACCGAATCTACAACGAGACCAACATTGACCCTTCATTCGCAAGCGAAAGGCAAGACAATTGCCCCTTA
CACCTAACTCAGGCGACG
ACAACCTGGCCCCACTGGACCTCAAAACGCCGAAGTCTTTCGACAACAACTACTACAACAACCTCATCCAGCAAAAGGGTCTTCTCCACTCCGACCAAGTCCTGTTCAACGGAGGATCAA
CCGATTCCCTTGTACGATCCTATAGCCAGAGACCGAAGGCATTCACTGCAGACTTGGCCGCGGCCATGGTTAAGATGGGAGATATCAAGCCCTTAACTGGGTCTCAGGGAGAGATCAGGA
ACGTATGTAGCAGACCTAATTAA

Retrieve as FASTA