Entry information : LuPrx173(Lus10030940|PACid:23166880)
Entry ID 12114
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx173(Lus10030940|PACid:23166880)
Name LuPrx173(Lus10030940|PACid:23166880)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx173
start..stop
S start..stop
LuPrx205 155 2e-48 19..94 1..76
ThasPrx02 106 1e-29 28..94 13..79
PtPrx83 105 3e-29 27..94 32..99
GmPrx105 100 2e-27 20..94 17..91
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106243..106464 222 N° 2 106563..106625 63  
join(106243..106464,106563..106625)


exon

Literature and cross-references LuPrx173(Lus10030940|PACid:23166880)
DNA ref. Phytozome 12:   scaffold261 (106243..106625)
Protein sequence: LuPrx173(Lus10030940|PACid:23166880)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   94 (68)
PWM (Da):   %s   10292.12 (7502.8) Transmb domain:   %s   o4-26i
PI (pH):   %s   6.91 (8.07) Peptide Signal:   %s   cut: 27 range:27-94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDHLMLSSSSMVLLLGIIMACSISQGQNLVQQYYKGTCPSAEAIVRYNVEDAVIKHPRIAASLIRLHFHDCFVMGCDGSLLLDTKGGRQSEKDA*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. Short PS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCATCTCATGCTCTCCTCCTCCTCCATGGTTCTTCTGCTAGGCATCATCATGGCTTGTTCCATTTCCCAAGGACAGAATCTGGTACAACAATACTACAAGGGAACATGCCCTTCT
GCAGAAGCGATTGTTAGGTACAATGTTGAGGATGCTGTGATCAAGCATCCTCGAATCGCGGCTTCCCTCATCCGCCTCCATTTTCATGACTGCTTTGTCATG
GTAAATTAAAGAGTTTGG
TTTCCACAAGTACTTTTGCAGCTGTAGTTATAGGTGTTTCATATGATTTGATAAAATCTTTTTGTTTGGGAAATATGTAGGGTTGTGATGGATCATTGCTTCTGGATACAAAAGGGGGAA
GGCAGAGTGAGAAGGATGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCATCTCATGCTCTCCTCCTCCTCCATGGTTCTTCTGCTAGGCATCATCATGGCTTGTTCCATTTCCCAAGGACAGAATCTGGTACAACAATACTACAAGGGAACATGCCCTTCT
GCAGAAGCGATTGTTAGGTACAATGTTGAGGATGCTGTGATCAAGCATCCTCGAATCGCGGCTTCCCTCATCCGCCTCCATTTTCATGACTGCTTTGTCATG
GGTTGTGATGGATCATTG
CTTCTGGATACAAAAGGGGGAAGGCAGAGTGAGAAGGATGCGTAA

Retrieve as FASTA