Entry information : LuPrx186 (Lus10034204|PACid:23175880)
Entry ID 12123
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-16 (Christophe Dunand)
Peroxidase information: LuPrx186 (Lus10034204|PACid:23175880)
Name (synonym) LuPrx186 (Lus10034204|PACid:23175880)
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx186
start..stop
S start..stop
LuPrx161 567 0 3..322 4..319
MePrx35 424 2.29e-150 9..322 8..316
GhPrx25 399 2.06e-140 1..322 11..328
MePrx123 398 2.82e-140 6..322 5..316
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12123' 'complement(join(48844..48946,49046..49343,49479..49644,49724..49915,49990..50199))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49990..50199 208 N° 2 49724..49915 190 N° 3 49479..49644 164 N° 4 49046..49343 296
N° 5 48844..48946 101  
complement(join(48844..48946,49046..49343,49479..49644,49724..49915,49990..50199 ))


exon

Literature and cross-references LuPrx186 (Lus10034204|PACid:23175880)
DNA ref. Phytozome 12:   scaffold310 (50199..48844)
Protein sequence: LuPrx186 (Lus10034204|PACid:23175880)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (303)
PWM (Da):   %s   35229.41 (33303.5)  
PI (pH):   %s   5.07 (5.07) Peptide Signal:   %s   cut: 20 range:20-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPCTTFCLILSLAAVGYAASSESLSPEYYVKTCPEARAIVKAVV
VAALKNETRMGASLLRLHFHDCFVN
GCDASILLDDNTTFVGEKTASPNINSTRGYEVIDKIKAQVEEACPGVVSCADILALAAMDSVVYLGGPWWEVGLGRRDSNTASKEAAEVSLPQPTFNLSDLAANFWAHGLSFRDLVALSG
AHTIGKARCTTFRDHIYNDTDIDPTFAKWLRKICPPIGHDDVLTPLDYRTPLRFDNSYYVNLVNERGLLHSDQDLYDCNDDDSPARSLARTLYETRPS
GFFEDFSKGMIKMGEIMPLTGD
AGEIRKNCRKAN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns and 1 extra 3'). Incorrect prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTTGCACCACTTTCTGCTTAATTCTATCACTTGCTGCTGTTGGTTATGCAGCTTCCAGTGAAAGCCTGTCACCAGAATATTACGTGAAAACCTGCCCTGAAGCACGGGCCATA
GTCAAAGCAGTAGTTGTGGCAGCTCTGAAGAACGAGACTCGAATGGGGGCATCCCTCCTTCGCCTGCATTTCCACGACTGCTTTGTTAAC
GTGAGTAACGACTTACGAATAAAAGCGCAT
ACTTTCTTCAGGATATTTTATCGAATTGTGGATTTTTTTGGCAGGGGGATGTGATGCATCGATTCTGCTCGATGACAACACAACTTTCGTCGGGGAGAAAACTGCATCCCCCAACATCAA
CTCCACCAGAGGGTATGAAGTTATAGACAAGATCAAAGCTCAAGTGGAAGAAGCCTGCCCTGGAGTTGTGTCTTGTGCTGATATACTTGCCTTGGCTGCCATGGACTCTGTGGTTTAT
GT
ATGTTCTTTCTTTCCCTTTTTTCATGATTTCAGCTTTTGTAAATCTCTGTATCGAATGAATGTTTCGAAAATCGCAGCTCTAGGAGGACCTTGGTGGGAAGTTGGATTGGGAAGAAGGGA
CTCCAACACTGCAAGCAAAGAAGCTGCTGAAGTATCCTTACCTCAACCAACATTCAATCTGAGTGATTTAGCTGCAAACTTTTGGGCACACGGCCTTTCTTTCCGGGACCTGGTTGCACT
TTCAG
GTGATCATGATCAAAAACTGGGGTGGAATTGTGATCGTAGACTTAAATCGTAAAATCTTAAGATTTTATGAACTACTGCCTAAGACATTTAAGAACATGATGCATTAAACATGTA
CTACATTGACGGTGATGTAGGTGTGCACACACAATAGGGAAGGCGAGATGCACAACATTTCGAGACCACATCTATAACGACACGGACATCGACCCAACATTCGCAAAATGGCTGCGGAAG
ATCTGCCCTCCAATTGGACACGATGACGTCCTCACACCTCTCGACTATCGAACTCCGCTCCGTTTCGACAATTCCTACTACGTCAACTTGGTCAACGAGAGAGGTCTCCTCCACTCGGAC
CAGGACCTGTACGATTGCAATGATGATGATTCCCCGGCCCGTTCTCTTGCCAGAACTCTGTACGAAACTCGACCTTCAGG
GTTGTTCAATGACTTGTTCAACAAGATAGCCAAGATCAGG
CTGTTCACCGAAAACCACGCTGCTTCGATTGTTCGAAACTACGTCGATCATCCTACGGTGTGTTTTTCGAGGATTTCAGTAAGGGGATGATCAAAATGGGGGAGATTATGCCTCTCACCG
GAGATGCAGGAGAGATCAGGAAGAACTGCCGAAAAGCCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCTTGCACCACTTTCTGCTTAATTCTATCACTTGCTGCTGTTGGTTATGCAGCTTCCAGTGAAAGCCTGTCACCAGAATATTACGTGAAAACCTGCCCTGAAGCACGGGCCATA
GTCAAAGCAGTAGTTGTGGCAGCTCTGAAGAACGAGACTCGAATGGGGGCATCCCTCCTTCGCCTGCATTTCCACGACTGCTTTGTTAAC
GGATGTGATGCATCGATTCTGCTCGATGAC
AACACAACTTTCGTCGGGGAGAAAACTGCATCCCCCAACATCAACTCCACCAGAGGGTATGAAGTTATAGACAAGATCAAAGCTCAAGTGGAAGAAGCCTGCCCTGGAGTTGTGTCTTGT
GCTGATATACTTGCCTTGGCTGCCATGGACTCTGTGGTTTAT
CTAGGAGGACCTTGGTGGGAAGTTGGATTGGGAAGAAGGGACTCCAACACTGCAAGCAAAGAAGCTGCTGAAGTATCC
TTACCTCAACCAACATTCAATCTGAGTGATTTAGCTGCAAACTTTTGGGCACACGGCCTTTCTTTCCGGGACCTGGTTGCACTTTCAG
GTGCACACACAATAGGGAAGGCGAGATGCACA
ACATTTCGAGACCACATCTATAACGACACGGACATCGACCCAACATTCGCAAAATGGCTGCGGAAGATCTGCCCTCCAATTGGACACGATGACGTCCTCACACCTCTCGACTATCGAACT
CCGCTCCGTTTCGACAATTCCTACTACGTCAACTTGGTCAACGAGAGAGGTCTCCTCCACTCGGACCAGGACCTGTACGATTGCAATGATGATGATTCCCCGGCCCGTTCTCTTGCCAGA
ACTCTGTACGAAACTCGACCTTCAGG
GTTTTTCGAGGATTTCAGTAAGGGGATGATCAAAATGGGGGAGATTATGCCTCTCACCGGAGATGCAGGAGAGATCAGGAAGAACTGCCGAAAA
GCCAACTGA

Retrieve as FASTA