Entry information : LuPrx188(Lus10034547|PACid:23162824)
Entry ID 12125
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx188(Lus10034547|PACid:23162824)
Name LuPrx188(Lus10034547|PACid:23162824)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx188
start..stop
S start..stop
CpapPrx26 516 0 10..319 14..322
PtPrx65 508 0 11..319 11..317
EcamPrx92 506 0 7..319 8..316
CsPrx27 504 0 9..318 3..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 493293..493505 213 N° 2 492999..493187 189 N° 3 491714..492271 558  
complement(join(491714..492271,492999..493187,493293..493505))


exon

Literature and cross-references LuPrx188(Lus10034547|PACid:23162824)
DNA ref. Phytozome 12:   scaffold9 (493505..491714)
Protein sequence: LuPrx188(Lus10034547|PACid:23162824)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (294)
PWM (Da):   %s   34618.86 (31732.3) Transmb domain:   %s   i9-31o
PI (pH):   %s   9.88 (9.76) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTTGPVRAFLLIIFTTIFFSSVNSLSLNYYDKTCPNLESAVTNAVKKAMSNDRTVPAALLRMHFHDCFIRGCDGSVLLKSTKNNVAEKDGPPNISLHAFYVIDHAKEAVEKLCPGIVSCADILALAARDAVALSGGPNWVVPKGRKDGRISKAIETRQLPAPVFNISQLQQSFSQRGLSTKDLVALSGGHTLGFAHCSSFQNRIHSFNASLDVDSTLSPSFAASLRKVCPRRNKVKNAGSTLDSTTFGFDNVYYKMLLSGKSIFSSDQALLTNPKTRSLVSKFAASEKAFEDAFVKSMIKMSSITGGQEIRLDCKVVR*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTACTACTGGTCCAGTTCGAGCCTTCCTTCTAATTATCTTCACAACAATCTTCTTCTCCTCTGTCAATTCCCTTAGCCTCAACTACTACGACAAAACCTGCCCTAACCTTGAATCA
GCAGTCACCAATGCCGTCAAGAAAGCCATGTCAAACGACAGAACCGTCCCTGCTGCCCTGCTCCGAATGCACTTCCACGACTGTTTCATTCGG
GTATGAACCACCCTTTTCGATCTTAAA
GTAATTACGTTTAGTTAATGTTAGGAACATAGGATGTATCTTTTTCTGAAGGCTCTGTGGTTTGGTTTTTCTTTCAAGGGTTGTGATGGCTCGGTGCTGTTGAAGTCAACCAAAAATAAT
GTGGCAGAGAAAGATGGGCCACCAAACATTTCACTCCATGCGTTTTATGTTATTGACCATGCCAAGGAAGCTGTTGAAAAACTGTGCCCTGGTATCGTCTCTTGTGCTGATATTCTGGCT
CTCGCTGCTAGGGATGCCGTTGCTTTG
GTAAGTTAAATTCTTAACAACACAACACACTTACTAGTTTGATTTTACGCTTCACTTGGTGGAAATGATAAATTATGACTATTATATCATAAC
GACTTTATATGAGTCCGAATTTGAATCTGGAGAAACTTTATGGATCTGATCCAGAAAACACATACATCTCAACAGTTTCAAAATAGTGATTTAGACGGCTGAAAACATAGGGTAAAAATA
TATTTCACAACCATCCAAATGTCTATCCTAAGTATTATATTAAGTATTGTTAGTATAATACTTAGCATGACACTTAGTATTACACTTTGTACAAAAGTCATACAAATATGTATACACTTT
TGTACGGGTTTGTACATGCCTACATATTTGTATGATCCGTACAACTCTCCATACAAGGTTGTACGACCTGTCGTGGGAAAATACTTCTTGAAATGTAGAGCCGACGATGGTGGTCACGTG
GGTGCAAAGTTTTTCTTCAACGGAGGTCAGAACCGACTAGAATTTGATTGGGAAATTTTCCTGTGAACAGAGATTGTTGTCCGTCGATCGAAGATGACTAGATCCTAGTCCAACAAAAAT
ATTTAAAACAACATGACCATATTACCCTTGATGAAGTTTAGCCCTTAGATCATATGGAAATCCAAAGACCCAGATTACTTCTAGATCAAATTCATGAAGCAATGTCATTGGCTCGAGAAT
AGGACTCACTTTGTATGTCATTTACATTTCTCAGTCTGGAGGTCCAAACTGGGTAGTCCCAAAAGGCCGAAAAGACGGACGAATCTCCAAGGCTATCGAGACTAGACAATTACCGGCTCC
AGTCTTCAACATCTCTCAACTCCAGCAAAGCTTCTCACAGAGAGGTCTTTCCACGAAAGACCTTGTTGCACTTTCAGGAGGGCACACTCTAGGATTTGCACATTGTTCCTCGTTCCAGAA
CAGGATCCACAGTTTCAATGCTAGCCTAGATGTCGACTCCACCCTATCCCCATCTTTTGCGGCGAGCTTGAGGAAAGTTTGCCCGCGTAGGAACAAGGTTAAGAATGCTGGGTCGACTTT
GGATTCCACGACTTTTGGGTTCGACAATGTTTATTACAAAATGCTGCTCAGTGGGAAGAGCATTTTCTCGTCGGACCAGGCTCTGTTGACGAACCCAAAGACGAGATCTTTGGTTTCGAA
GTTTGCTGCAAGCGAGAAGGCATTTGAGGATGCGTTTGTGAAATCCATGATTAAGATGAGTAGTATCACTGGTGGGCAGGAGATTCGGCTTGATTGTAAGGTCGTGAGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTACTACTGGTCCAGTTCGAGCCTTCCTTCTAATTATCTTCACAACAATCTTCTTCTCCTCTGTCAATTCCCTTAGCCTCAACTACTACGACAAAACCTGCCCTAACCTTGAATCA
GCAGTCACCAATGCCGTCAAGAAAGCCATGTCAAACGACAGAACCGTCCCTGCTGCCCTGCTCCGAATGCACTTCCACGACTGTTTCATTCGG
GGTTGTGATGGCTCGGTGCTGTTGAAG
TCAACCAAAAATAATGTGGCAGAGAAAGATGGGCCACCAAACATTTCACTCCATGCGTTTTATGTTATTGACCATGCCAAGGAAGCTGTTGAAAAACTGTGCCCTGGTATCGTCTCTTGT
GCTGATATTCTGGCTCTCGCTGCTAGGGATGCCGTTGCTTTG
TCTGGAGGTCCAAACTGGGTAGTCCCAAAAGGCCGAAAAGACGGACGAATCTCCAAGGCTATCGAGACTAGACAATTA
CCGGCTCCAGTCTTCAACATCTCTCAACTCCAGCAAAGCTTCTCACAGAGAGGTCTTTCCACGAAAGACCTTGTTGCACTTTCAGGAGGGCACACTCTAGGATTTGCACATTGTTCCTCG
TTCCAGAACAGGATCCACAGTTTCAATGCTAGCCTAGATGTCGACTCCACCCTATCCCCATCTTTTGCGGCGAGCTTGAGGAAAGTTTGCCCGCGTAGGAACAAGGTTAAGAATGCTGGG
TCGACTTTGGATTCCACGACTTTTGGGTTCGACAATGTTTATTACAAAATGCTGCTCAGTGGGAAGAGCATTTTCTCGTCGGACCAGGCTCTGTTGACGAACCCAAAGACGAGATCTTTG
GTTTCGAAGTTTGCTGCAAGCGAGAAGGCATTTGAGGATGCGTTTGTGAAATCCATGATTAAGATGAGTAGTATCACTGGTGGGCAGGAGATTCGGCTTGATTGTAAGGTCGTGAGGTGA

Retrieve as FASTA