1. Browse the Database
  2. View Redoxidase
Entry information : LuGPx19 (Lus10003421|PACid:23164879)
Entry ID 12126
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-02-09 (Christophe Dunand)
Peroxidase information: LuGPx19 (Lus10003421|PACid:23164879)
Name (synonym) LuGPx19 (Lus10003421|PACid:23164879)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx19
start..stop		 S start..stop
LuGPx140 457 2.18e-164 1..235 1..235
LuGPx211 358 1.86e-125 1..235 1..232
PtGPx01 344 4.7e-120 37..235 27..223
CclGPx01 333 1.4e-115 1..235 1..236
Gene structure Fichier Exons►


exon

Literature and cross-references LuGPx19 (Lus10003421|PACid:23164879)
DNA ref. Phytozome 12:   scaffold543 (25829..22855)
Protein sequence: LuGPx19 (Lus10003421|PACid:23164879)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338
PWM (Da):   %s   37219.04 Transmb domain:   %s   i5-27o
PI (pH):   %s   9.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSLMFAATLSSPSHMYIAERPSCYSPSQQSFGVSVASARSSLLFPSSKSGFLRHGLSLKSQNSAGLVRKNPSFRVFARAATEKSIHDFTVKDIDGKNVSLSKFKGKALLIVNVASRCG
LTSSNYSELSHVYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKQFACTRFKAEFPIFDNVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYAPTTSPFQIEVWELW
KAGRATEVIDSSLSLDNSHEALRCIKIRLLCVEENAANRPDMQTVVLILNSETSSVPFPQKPAFVVSAISKVSPTIERTCSVNEMSFSGILRKRETLK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA ►
Send to BLAST
CDS►
Send to BLAST