Entry information : LuPrx192 (Lus10035925)
Entry ID 12128
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2014-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-05-23 (Christophe Dunand)
Peroxidase information: LuPrx192 (Lus10035925)
Name (synonym) LuPrx192 (Lus10035925)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx192
start..stop
S start..stop
RcPrx30 494 2.42e-177 17..331 8..319
CclPrx39 491 4.75e-176 17..331 7..316
CsPrx06 490 8.15e-176 17..331 7..316
AtPrx17 489 2.62e-175 18..331 7..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12128' 'join(290588..290827,290909..291100,291188..291826)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 290588..290827 238 N° 2 290909..291100 190 N° 3 291188..291826 637  
join(290588..290827,290909..291100,291188..291826)


exon

Literature and cross-references LuPrx192 (Lus10035925)
Literature Day A, Fénart S, Neutelings G, Hawkins S, Rolando C, Tokarski C. Identification of cell wall proteins in the flax (Linum usitatissimum) stem. Proteomics. 2013 13(5):812-25.
DNA ref. GenBank:   AFSQ01019756.1 Phytozome 12:   scaffold76 (290807..291826)
EST ref. GenBank:   JG237679.1 (28363..29601) [3' end]
Protein sequence: LuPrx192 (Lus10035925)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356 (327)
PWM (Da):   %s   38810.09 (35852.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.24 (5.24) Peptide Signal:   %s   cut: 30 range:30-356
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLLSAAVAAAAATATFLLLLISFSSSFATTTSLRPGYYSTTCPAAESIVRQVMFNALSSSDPRSVASVMRFQFHDCFVNGCDGSMLLDDTDTMLGEKLSLSNIDSLRSYNLVDQIKSRL
EKSCPGVVSCADIIIMASRDAVSLTGGPQWEVKLGRLDSLTASQADADAIMPSPRANATMLIDLFERFNLSVKDMVALSGSHSIGKGRCFSIQFRLYNQSGSGRPDPAIEPGYRQKLMEL
CPMGGDENVTVGLDSTPLVFDNMYFKDLVGGRGFLNSDETLFTYPITREYVEEFSRDEDAFFEAFAEGMIKMGDLQSGLPGEVRRNCRVANGGRQVSNRLSSFSSPGRHYRSKKVM*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (exon 1 is missing but not found in the genomic, longer 3' found from ESTs => VANGGRRQVSNRLSSFS). Experimental evidency of cell wall localization.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTTCTCTCGGCAGCAGTAGCAGCAGCAGCAGCCACGGCGACGTTTCTCCTTCTGTTAATCTCCTTCTCCTCCTCTTTCGCCACCACCACATCTCTCCGGCCTGGATACTACTCC
ACCACCTGCCCTGCCGCCGAATCCATCGTCAGACAAGTGATGTTCAACGCCCTCTCCTCCTCCGACCCACGAAGTGTTGCCTCCGTCATGCGTTTCCAATTCCACGACTGCTTCGTCAAT
ATGTAAACATCCATTTCTTCAAAAAATAATTCCCTAAACCCCTTTATCTCTAATTTGGAATTAATCTCTGTTTTTTGTTTGAGGGATGTGATGGTTCGATGCTGCTGGATGACACGGACA
CCATGCTAGGGGAGAAACTTTCCCTTTCCAATATCGATTCCCTCCGATCATACAACCTCGTCGACCAAATCAAGTCGCGGCTTGAGAAATCATGCCCCGGTGTCGTCTCCTGCGCCGACA
TCATCATCATGGCCTCCCGTGACGCTGTTTCCCTC
TCGTAATCAATTGCATCTAATAATCTCCCACGGTTTCTTCTTTTCCTTAATTACTCTGTTTAGATTTCTTTTTTTTTTATCTGTT
GCAGACGGGTGGGCCCCAGTGGGAAGTGAAGCTAGGGAGGCTGGACAGTCTGACGGCGAGCCAGGCCGACGCCGACGCAATCATGCCAAGCCCGAGAGCCAACGCGACGATGCTGATCGA
CCTCTTCGAGAGATTCAACCTCTCTGTAAAAGACATGGTTGCGCTCTCAGGGTCCCACTCCATAGGGAAAGGACGCTGCTTCTCCATCCAGTTCCGCCTCTACAACCAGTCGGGGTCGGG
CCGGCCCGACCCGGCAATCGAGCCAGGGTACAGGCAGAAGCTGATGGAGCTTTGCCCGATGGGGGGAGACGAGAACGTGACGGTGGGTTTGGATTCGACTCCGCTAGTGTTCGACAACAT
GTATTTCAAGGATTTGGTGGGCGGGAGAGGGTTCTTGAACTCCGACGAAACGCTCTTCACTTATCCAATCACCAGGGAGTACGTGGAGGAGTTCAGCAGGGATGAGGATGCGTTTTTTGA
GGCGTTTGCGGAAGGGATGATTAAGATGGGTGACTTGCAGTCTGGGCTGCCAGGTGAAGTCAGGAGGAACTGTCGGGTTGCTAATGGCGGCCGGCAGGTCAGCAATCGATTGAGCAGCTT
CAGTTCCCCCGGCCGCCATTACAGATCAAAGAAAGTAATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTTCTCTCGGCAGCAGTAGCAGCAGCAGCAGCCACGGCGACGTTTCTCCTTCTGTTAATCTCCTTCTCCTCCTCTTTCGCCACCACCACATCTCTCCGGCCTGGATACTACTCC
ACCACCTGCCCTGCCGCCGAATCCATCGTCAGACAAGTGATGTTCAACGCCCTCTCCTCCTCCGACCCACGAAGTGTTGCCTCCGTCATGCGTTTCCAATTCCACGACTGCTTCGTCAAT
GGATGTGATGGTTCGATGCTGCTGGATGACACGGACACCATGCTAGGGGAGAAACTTTCCCTTTCCAATATCGATTCCCTCCGATCATACAACCTCGTCGACCAAATCAAGTCGCGGCTT
GAGAAATCATGCCCCGGTGTCGTCTCCTGCGCCGACATCATCATCATGGCCTCCCGTGACGCTGTTTCCCTC
ACGGGTGGGCCCCAGTGGGAAGTGAAGCTAGGGAGGCTGGACAGTCTG
ACGGCGAGCCAGGCCGACGCCGACGCAATCATGCCAAGCCCGAGAGCCAACGCGACGATGCTGATCGACCTCTTCGAGAGATTCAACCTCTCTGTAAAAGACATGGTTGCGCTCTCAGGG
TCCCACTCCATAGGGAAAGGACGCTGCTTCTCCATCCAGTTCCGCCTCTACAACCAGTCGGGGTCGGGCCGGCCCGACCCGGCAATCGAGCCAGGGTACAGGCAGAAGCTGATGGAGCTT
TGCCCGATGGGGGGAGACGAGAACGTGACGGTGGGTTTGGATTCGACTCCGCTAGTGTTCGACAACATGTATTTCAAGGATTTGGTGGGCGGGAGAGGGTTCTTGAACTCCGACGAAACG
CTCTTCACTTATCCAATCACCAGGGAGTACGTGGAGGAGTTCAGCAGGGATGAGGATGCGTTTTTTGAGGCGTTTGCGGAAGGGATGATTAAGATGGGTGACTTGCAGTCTGGGCTGCCA
GGTGAAGTCAGGAGGAACTGTCGGGTTGCTAATGGCGGCCGGCAGGTCAGCAATCGATTGAGCAGCTTCAGTTCCCCCGGCCGCCATTACAGATCAAAGAAAGTAATGTAA

Retrieve as FASTA