Entry information : LuPrx196(Lus10038054|PACid:23163650)
Entry ID 12129
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx196(Lus10038054|PACid:23163650)
Name LuPrx196(Lus10038054|PACid:23163650)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx196
start..stop
S start..stop
RcPrx02 448 2e-159 31..337 32..331
MePrx89 446 7e-159 9..337 11..334
MePrx80 444 5e-158 31..337 32..334
AcoPrx60 428 8e-152 14..337 3..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1054491..1054718 228 N° 2 1055092..1055877 786  
join(1054491..1054718,1055092..1055877)


exon

Literature and cross-references LuPrx196(Lus10038054|PACid:23163650)
DNA ref. Phytozome 12:   scaffold475 (1054491..1055877)
Protein sequence: LuPrx196(Lus10038054|PACid:23163650)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (309)
PWM (Da):   %s   36549.29 (33597.8) Transmb domain:   %s   i9-31o
PI (pH):   %s   8.9 (9.08) Peptide Signal:   %s   cut: 29 range:29-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSHQSLVSQVLLLLVLMMIAAAADGHGLRVGYYKKTCPSVESIVRKAVNKALSRDPKLGGGLIRMHFHDCFVRGCDGSVLLDPVRGAPPEKNHPANGVTLRGFEVINEAKSQIESVCPNTVSCADIVTFAARDSSYNLGHIYYAVPSGRRDGRISKFDEVAENLPPPSFNAEQLIANFARKGMSLDEMVTLSGAHSIGEAHCSSFSERLYSFNQTHSQDPSLNRAFAARLRARCPRPSSNNGGGGNSSDPTVGLDPTPDHLDNKYYVELQRGRALLASDQTLMDSRLTRWNVVNNARNGATWAAKFAKAMQHMGSLDVLTGKQGEIRRVCTSVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGTTCGAGTCATCAATCTTTGGTTTCCCAGGTGCTGCTGCTACTAGTATTAATGATGATTGCTGCAGCGGCGGACGGTCATGGTCTTAGAGTTGGATACTACAAGAAGACTTGT
CCGTCGGTCGAATCTATCGTGAGGAAAGCGGTCAACAAGGCTCTGTCTCGTGATCCCAAACTCGGAGGTGGGCTCATCCGGATGCATTTCCACGACTGCTTTGTTCGG
GTACGTGCTATA
CATATAACTCCCTCAATGTGAAATTTGGACTTTCTCAATCCAAAAGTTCGTTTTCTTTTATGAATGAAAGATCTTATTAACAAAATGATGACTGAGGCAAACAAGAATATCAAACTCATA
TCCCACTTCCATGACAACAGACGACCACACCCTCTAATTCAGAAGTTCGTTGAGAGCAGACTTTTAAATTGGAACTAAATTGTGAATGGATGAGGGAGTTTGAGTTAGATACGAAATTAT
TGGGTCTTCTTACTTCAAAAACTTACAAGTAGTTTCGAGTTAAGATATGATATGAAATCATCTTGCCACAATGGAACTATAAAGCTTGAATAATTTTGAAATTTTGGATATTTTTTTGTA
GGGATGTGATGGCTCCGTGCTACTGGATCCCGTCCGTGGGGCGCCACCAGAGAAGAACCACCCGGCTAACGGTGTGACCCTACGCGGTTTCGAGGTAATCAACGAAGCCAAATCGCAAAT
TGAGTCGGTCTGTCCAAACACCGTCTCTTGCGCCGACATCGTCACCTTTGCCGCTAGAGACAGCTCCTACAACCTCGGACACATATACTACGCAGTCCCCTCAGGGCGTCGCGACGGCCG
CATCTCAAAATTTGACGAAGTCGCCGAAAACCTCCCTCCTCCGTCCTTCAACGCCGAGCAGCTCATCGCGAATTTCGCCCGAAAGGGGATGTCCCTCGACGAGATGGTCACACTCTCCGG
TGCGCATTCCATCGGGGAGGCTCACTGCTCTTCGTTCTCCGAGCGTCTCTATTCTTTTAACCAAACGCATTCCCAAGACCCTTCCCTCAATAGGGCCTTTGCGGCCAGGTTGAGGGCCAG
GTGTCCCCGACCATCGTCAAACAACGGCGGCGGCGGAAACAGCAGCGACCCGACCGTGGGACTGGACCCCACACCGGATCATCTGGACAACAAGTATTACGTGGAGTTGCAACGTGGTCG
AGCACTGCTGGCGTCGGACCAAACACTGATGGATAGCAGGTTGACTAGGTGGAATGTGGTCAACAATGCCAGAAATGGTGCCACGTGGGCTGCCAAGTTTGCAAAGGCAATGCAACATAT
GGGTTCTCTTGACGTTCTCACGGGGAAGCAAGGTGAGATCAGGAGGGTGTGTACCTCTGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGTTCGAGTCATCAATCTTTGGTTTCCCAGGTGCTGCTGCTACTAGTATTAATGATGATTGCTGCAGCGGCGGACGGTCATGGTCTTAGAGTTGGATACTACAAGAAGACTTGT
CCGTCGGTCGAATCTATCGTGAGGAAAGCGGTCAACAAGGCTCTGTCTCGTGATCCCAAACTCGGAGGTGGGCTCATCCGGATGCATTTCCACGACTGCTTTGTTCGG
GGATGTGATGGC
TCCGTGCTACTGGATCCCGTCCGTGGGGCGCCACCAGAGAAGAACCACCCGGCTAACGGTGTGACCCTACGCGGTTTCGAGGTAATCAACGAAGCCAAATCGCAAATTGAGTCGGTCTGT
CCAAACACCGTCTCTTGCGCCGACATCGTCACCTTTGCCGCTAGAGACAGCTCCTACAACCTCGGACACATATACTACGCAGTCCCCTCAGGGCGTCGCGACGGCCGCATCTCAAAATTT
GACGAAGTCGCCGAAAACCTCCCTCCTCCGTCCTTCAACGCCGAGCAGCTCATCGCGAATTTCGCCCGAAAGGGGATGTCCCTCGACGAGATGGTCACACTCTCCGGTGCGCATTCCATC
GGGGAGGCTCACTGCTCTTCGTTCTCCGAGCGTCTCTATTCTTTTAACCAAACGCATTCCCAAGACCCTTCCCTCAATAGGGCCTTTGCGGCCAGGTTGAGGGCCAGGTGTCCCCGACCA
TCGTCAAACAACGGCGGCGGCGGAAACAGCAGCGACCCGACCGTGGGACTGGACCCCACACCGGATCATCTGGACAACAAGTATTACGTGGAGTTGCAACGTGGTCGAGCACTGCTGGCG
TCGGACCAAACACTGATGGATAGCAGGTTGACTAGGTGGAATGTGGTCAACAATGCCAGAAATGGTGCCACGTGGGCTGCCAAGTTTGCAAAGGCAATGCAACATATGGGTTCTCTTGAC
GTTCTCACGGGGAAGCAAGGTGAGATCAGGAGGGTGTGTACCTCTGTGAACTGA

Retrieve as FASTA