Entry information : LuPrx209 (Lus10041784|PACid:23146664)
Entry ID 12140
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-08-12 (Christophe Dunand)
Peroxidase information: LuPrx209 (Lus10041784|PACid:23146664)
Name (synonym) LuPrx209 (Lus10041784|PACid:23146664)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type Seed coats
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx209
start..stop
S start..stop
RcPrx17 581 0 1..331 1..330
NnPrx50 578 0 1..331 1..330
MePrx01 577 0 1..331 1..330
PbPrx02 577 0 1..331 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1751318..1751545 228 N° 2 1751009..1751200 192 N° 3 1750093..1750668 576  
complement(join(1750093..1750668,1751009..1751200,1751318..1751545))


exon

Literature and cross-references LuPrx209 (Lus10041784|PACid:23146664)
DNA ref. Phytozome 12:   scaffold272 (1751545..1750093)
EST ref. GenBank:   JG242660.1 [3' end]
Protein sequence: LuPrx209 (Lus10041784|PACid:23146664)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (308)
PWM (Da):   %s   36284.19 (33682.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.1 (9.20) Peptide Signal:   %s   cut: 24 range:24-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARSVSFVFVVVSLLAFAPFCLCGKNIGGYLYPQFYDYSCPQAHQIVKSVVAKAVAKEPRMAASLLRLHFHDCFVKGCDASILLDGGSGIATEKNSNPNRNSARGFEVIDDIKSALEKECPNKVSCADILTLAARDSTVLAGGPSWEVPLGRKDSRSASLSGSNNNIPAPNNTFQTILTKFKLQGLNTVDLVALSGSHTIGNSRCTSFRQRLYNQTGNGLPDYSLDSTYASQMKTRCPRSGGDQNLFFLDFQSPMHFDNSYFKNILASKGLLNSDQVLLTKNEASMELVKQYAENNELFFQQFAKSMVKMGNISPLTGSKGEIRKNCRKMN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGATCTGTTAGCTTTGTTTTCGTTGTTGTCTCTCTTCTAGCCTTCGCTCCATTTTGCTTGTGTGGTAAGAACATTGGTGGGTACCTTTACCCTCAGTTCTATGACTACTCTTGC
CCTCAAGCTCACCAGATTGTCAAGTCTGTTGTGGCCAAGGCCGTTGCCAAAGAACCCCGGATGGCTGCTTCTTTGCTCAGGCTGCATTTCCATGACTGCTTCGTAAAG
GTTTCGACTTTT
GCCTTGACCCCAAAAAACGTTAACAGTTCTTTTGTCACAATATTCCTTATAAGTAAGAGTAACTAATAGGTTTTTGCTGAATTATATGTAATTTTATTGTACCAGGGATGTGATGCTTCA
ATTCTGCTGGATGGCGGTTCAGGCATTGCAACTGAGAAGAACTCGAATCCGAATCGGAATTCTGCCAGAGGATTTGAAGTGATCGATGACATCAAGTCTGCATTGGAGAAGGAATGTCCT
AACAAAGTTTCTTGTGCTGATATCCTGACCCTAGCTGCCAGAGACTCCACTGTACTT
GTGAGTGTTCAGTTTGTAATTAACTTTTCTCTCAGCATAAACCAACCCTTCATCTCAGTAACT
CGAGTAATTAAAAAAGATTCTCTTACATCCCCTCAAACAAAAACACCTGAAAGGAGATTGAAGTTTCACAGGTTCCTTGTCCATATGAAATTGTTATATTTGAGGGCTGACAGAATTTGA
TCCCAGAACCTTTCAGTCAAATTGGACGGTGAGAAGGCTCTCATATACCATATGGAAAATTGTTGAATCCCAATAGTTTAAGTTGTTGGGAAAGGTCCATATTTAATTAGCATTATGAAA
CTGGAATCCTGAAACAATGTTGTTGGCTTTCTTGAAGGCTGGAGGACCAAGCTGGGAGGTACCATTGGGGAGAAAGGACTCAAGAAGTGCAAGCTTGAGTGGTTCCAACAACAACATTCC
AGCTCCAAACAACACATTCCAGACAATCCTGACAAAGTTCAAGCTCCAAGGCCTCAACACTGTGGACCTTGTAGCATTGTCAGGAAGCCACACCATCGGGAATTCGAGGTGCACGAGCTT
CCGGCAGAGGCTGTACAACCAGACGGGAAACGGCCTACCAGATTACAGCCTCGATTCCACCTATGCCTCCCAGATGAAAACCAGGTGCCCTCGTTCAGGAGGCGATCAGAACCTGTTCTT
CTTGGATTTCCAGTCTCCGATGCATTTCGATAACAGCTACTTCAAGAACATATTGGCTTCTAAGGGGCTGCTCAACTCTGACCAGGTTCTCCTCACGAAGAATGAAGCATCCATGGAGTT
GGTCAAGCAGTATGCTGAGAATAACGAGCTTTTCTTCCAGCAGTTTGCTAAGTCAATGGTTAAGATGGGAAATATCTCACCTTTGACTGGCTCCAAGGGAGAGATAAGGAAGAACTGCAG
GAAGATGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGATCTGTTAGCTTTGTTTTCGTTGTTGTCTCTCTTCTAGCCTTCGCTCCATTTTGCTTGTGTGGTAAGAACATTGGTGGGTACCTTTACCCTCAGTTCTATGACTACTCTTGC
CCTCAAGCTCACCAGATTGTCAAGTCTGTTGTGGCCAAGGCCGTTGCCAAAGAACCCCGGATGGCTGCTTCTTTGCTCAGGCTGCATTTCCATGACTGCTTCGTAAAG
GGATGTGATGCT
TCAATTCTGCTGGATGGCGGTTCAGGCATTGCAACTGAGAAGAACTCGAATCCGAATCGGAATTCTGCCAGAGGATTTGAAGTGATCGATGACATCAAGTCTGCATTGGAGAAGGAATGT
CCTAACAAAGTTTCTTGTGCTGATATCCTGACCCTAGCTGCCAGAGACTCCACTGTACTT
GCTGGAGGACCAAGCTGGGAGGTACCATTGGGGAGAAAGGACTCAAGAAGTGCAAGCTTG
AGTGGTTCCAACAACAACATTCCAGCTCCAAACAACACATTCCAGACAATCCTGACAAAGTTCAAGCTCCAAGGCCTCAACACTGTGGACCTTGTAGCATTGTCAGGAAGCCACACCATC
GGGAATTCGAGGTGCACGAGCTTCCGGCAGAGGCTGTACAACCAGACGGGAAACGGCCTACCAGATTACAGCCTCGATTCCACCTATGCCTCCCAGATGAAAACCAGGTGCCCTCGTTCA
GGAGGCGATCAGAACCTGTTCTTCTTGGATTTCCAGTCTCCGATGCATTTCGATAACAGCTACTTCAAGAACATATTGGCTTCTAAGGGGCTGCTCAACTCTGACCAGGTTCTCCTCACG
AAGAATGAAGCATCCATGGAGTTGGTCAAGCAGTATGCTGAGAATAACGAGCTTTTCTTCCAGCAGTTTGCTAAGTCAATGGTTAAGATGGGAAATATCTCACCTTTGACTGGCTCCAAG
GGAGAGATAAGGAAGAACTGCAGGAAGATGAATTAA

Retrieve as FASTA