Entry information : LuPrx21(Lus10004163|PACid:23153333)
Entry ID 12141
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx21(Lus10004163|PACid:23153333)
Name LuPrx21(Lus10004163|PACid:23153333)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx21
start..stop
S start..stop
RcPrx16 482 5e-173 14..326 19..333
MePrx53 480 2e-172 9..326 13..332
EcamPrx55 480 2e-172 4..326 6..330
EgrPrx55 477 3e-171 4..326 6..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84166..84381 216 N° 2 83674..84037 364 N° 3 82841..83241 401  
complement(join(82841..83241,83674..84037,84166..84381))


exon

Literature and cross-references LuPrx21(Lus10004163|PACid:23153333)
DNA ref. Phytozome 12:   scaffold2404 (84381..82841)
Protein sequence: LuPrx21(Lus10004163|PACid:23153333)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   34289.65  
PI (pH):   %s   4.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFAPMVTMFSVTIIGLLFLGQSNAQLTSTFYATTCPNVSNVVSNVIQQALQSDARIAASLIRLHFHDCFVQGCDGSILLDDNSTANIQSEKNAGPNANSARGFPVVDSIKSAVENVCPGVVSCADILALAAEASVVQSGGPSWSVLLGRRDSRTANQGGANASIPAPFDNLANLTSKFSNVGLNTNDLVALSGAHTFGRAQCRTFVNRLYNFTGSGPDPTLSSSYATTLQQTCPQNGNGAALANLDPTTSDTFDNNYYSNLQNNQGLLQSDQALTGTSTMALVNAFSNNQTAFFQSFVQSMVNMGNISPLTGSSGEIRGDCKMIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTTTGCTCCAATGGTGACAATGTTTTCCGTGACGATAATTGGACTACTCTTCCTCGGCCAATCGAATGCTCAATTAACCTCGACGTTCTACGCCACCACCTGTCCCAACGTCTCT
AACGTCGTCAGCAACGTCATCCAGCAAGCTCTCCAGTCCGACGCCAGGATCGCCGCCAGCCTCATCCGCCTCCATTTCCACGATTGCTTCGTCCAG
GTACTATTCGTAACTAAAAGCATT
ACTAAAAACTGTCACGTTAATTTTCTGCGACGGTAAATTTTAGTGACCATAATTTTATCTGAATTAACGGTTTAGTGATGTTTTTTTTTTTGTTGAGTGAACAGGGGTGTGACGGGTCGA
TCTTGCTGGACGACAACTCGACGGCGAACATCCAGAGCGAGAAGAACGCAGGACCGAACGCCAACTCGGCGAGAGGGTTCCCGGTGGTGGACAGCATCAAGTCGGCCGTGGAAAACGTGT
GCCCTGGTGTTGTGTCCTGCGCGGACATCCTTGCTCTGGCCGCCGAGGCTTCCGTTGTGCAGTCCGGTGGGCCGTCGTGGAGCGTGCTGTTGGGGAGAAGGGACAGTCGAACTGCAAATC
AAGGAGGAGCCAACGCTTCGATTCCGGCTCCTTTCGATAACCTTGCGAATCTCACTTCGAAGTTCAGTAACGTTGGCCTTAACACCAACGATCTTGTTGCATTATCAG
GTAATTAACTAT
AAAATAGAATCATGATTCAATTGTTATATGAGAATAATTAATGACCAATTAAGTAACGAATTAAAGTTTAGTTCTTTCGTGCTTTTTCATACTCATTCGACCTTGTATTTATGTATCGTT
TGCTTATAGTTATTCAGTACAACAATCAGAGACGGATTCAGAATCAAAAGTTAAAACCCGGCCAATTATTGGAAAATATTTGATTGAATTACTAAAACACATCGAAATGTATACATTTGG
AAGTACAGATACTATAAAGATAAGGCTGCCAAAGTTGGTGCCAGAAACCGAACTTTGCCAGTAGATGTCAATATTTTAACTAAACTAGTAAATACTAGAGTACAAACTAATTAATTGAGT
AGCAGGTAACTAATTAACGACCCCAACTAAACTAATCTGTTTTTTTTTTAACTTTGGCAGGGGCCCACACGTTCGGCCGGGCACAGTGCCGTACATTCGTGAACCGGCTCTACAACTTCA
CCGGGTCGGGACCTGACCCGACTCTGAGCTCGTCGTATGCGACCACCCTGCAGCAGACGTGCCCACAAAACGGCAACGGAGCGGCATTGGCGAACCTCGATCCGACAACTTCCGACACTT
TCGACAACAACTACTACTCGAACCTCCAGAACAACCAGGGATTGTTGCAGTCTGACCAGGCGCTGACCGGGACTTCAACGATGGCCCTGGTCAACGCCTTCAGCAACAACCAAACAGCTT
TCTTCCAGAGTTTTGTACAGTCGATGGTCAACATGGGTAATATAAGCCCGTTGACCGGGAGCAGTGGCGAGATTAGAGGGGATTGTAAGATGATTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTTTGCTCCAATGGTGACAATGTTTTCCGTGACGATAATTGGACTACTCTTCCTCGGCCAATCGAATGCTCAATTAACCTCGACGTTCTACGCCACCACCTGTCCCAACGTCTCT
AACGTCGTCAGCAACGTCATCCAGCAAGCTCTCCAGTCCGACGCCAGGATCGCCGCCAGCCTCATCCGCCTCCATTTCCACGATTGCTTCGTCCAG
GGGTGTGACGGGTCGATCTTGCTG
GACGACAACTCGACGGCGAACATCCAGAGCGAGAAGAACGCAGGACCGAACGCCAACTCGGCGAGAGGGTTCCCGGTGGTGGACAGCATCAAGTCGGCCGTGGAAAACGTGTGCCCTGGT
GTTGTGTCCTGCGCGGACATCCTTGCTCTGGCCGCCGAGGCTTCCGTTGTGCAGTCCGGTGGGCCGTCGTGGAGCGTGCTGTTGGGGAGAAGGGACAGTCGAACTGCAAATCAAGGAGGA
GCCAACGCTTCGATTCCGGCTCCTTTCGATAACCTTGCGAATCTCACTTCGAAGTTCAGTAACGTTGGCCTTAACACCAACGATCTTGTTGCATTATCAG
GGGCCCACACGTTCGGCCGG
GCACAGTGCCGTACATTCGTGAACCGGCTCTACAACTTCACCGGGTCGGGACCTGACCCGACTCTGAGCTCGTCGTATGCGACCACCCTGCAGCAGACGTGCCCACAAAACGGCAACGGA
GCGGCATTGGCGAACCTCGATCCGACAACTTCCGACACTTTCGACAACAACTACTACTCGAACCTCCAGAACAACCAGGGATTGTTGCAGTCTGACCAGGCGCTGACCGGGACTTCAACG
ATGGCCCTGGTCAACGCCTTCAGCAACAACCAAACAGCTTTCTTCCAGAGTTTTGTACAGTCGATGGTCAACATGGGTAATATAAGCCCGTTGACCGGGAGCAGTGGCGAGATTAGAGGG
GATTGTAAGATGATTAATTAG

Retrieve as FASTA