Entry information : LuPrx213(Lus10043010|PACid:23167923)
Entry ID 12143
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx213(Lus10043010|PACid:23167923)
Name LuPrx213(Lus10043010|PACid:23167923)
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx213
start..stop
S start..stop
LuPrx179 660 0 1..336 1..335
PtPrx88 464 4.17e-166 24..327 22..324
MePrx68 452 1.8e-161 25..326 25..325
RcPrx68 442 2.62e-157 24..327 24..326
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12143' 'join(644258..644485,644581..644760,644903..645068,645671..646104)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 644258..644485 226 N° 2 644581..644760 178 N° 3 644903..645068 164 N° 4 645671..646104 432
join(644258..644485,644581..644760,644903..645068,645671..646104)


exon

Literature and cross-references LuPrx213(Lus10043010|PACid:23167923)
DNA ref. Phytozome 12:   scaffold25 (644258..646104)
Protein sequence: LuPrx213(Lus10043010|PACid:23167923)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   35617.24 Transmb domain:   %s   i7-29o
PI (pH):   %s   6.85
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMTKETAIAGFMVGLLLLSGDPLICYGALQVGFYRGKCGFADVEAIVGGLVSSHLFRDPSILASLIRLHFHDCFVNGCDASILLDGPDTEKTASPNHSVRGYEIIDQAKAAVDKICPGVV
SCADLIAIAARDAVFLSGGGIYRVQTGRKDGLVSSADIANVTLPGPSITVPQAVAAFADKGLTAVDMVLLLGAHSVGVAHCSFLDERIHNFRGSGRPDPSMDQFTANTLRSRCPINSIEN
TVNLDQNPFSPFVLDNSYYQNILLRRGVLQIDQELGMNRFTRPIVANLAGAIDFPARFGAAMVRLGAVGVLTGTQGEVRRSCRVVNKVVSKDESG*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGACCAAGGAGACGGCCATTGCTGGGTTTATGGTGGGGCTGCTACTACTCTCAGGAGATCCGTTGATTTGCTACGGTGCACTCCAAGTAGGATTTTACAGAGGGAAATGTGGCTTC
GCTGACGTGGAAGCCATCGTCGGCGGCCTCGTTTCCTCTCATCTCTTTAGAGACCCTTCCATCCTCGCTTCCCTTATCCGCCTCCATTTCCATGATTGTTTCGTCAAT
ATGTACCTACCT
ACCCTTACTTACTCACTAACCCTATTTCTGTTTGTTTGTTTGTCTGTTTTCTCACTCGATCTATGTTTACGCCTGTGTGGAAAAGGGCTGTGATGCATCCATTCTCCTGGACGGTCCAGA
CACCGAGAAAACCGCATCACCCAACCACAGTGTCAGAGGTTACGAGATTATCGACCAGGCTAAGGCCGCCGTCGACAAAATCTGCCCTGGTGTCGTTTCTTGTGCTGACCTCATTGCCAT
TGCCGCCCGCGACGCTGTTTTCCTC
TCGTAACTTCTTCTTCTTCTCCTTCTTCTTCTTCTTCTTCTTCATCATCATCACCACCATAACTCCTCATAACCCCCCCCCCCCCCCCCCCCTCC
CCTCNNNNNNNNNNNNCCCCCCCCCCCCCCCCTCAATTTTTTTGGACAGAGTGGAGGAGGTATATACAGAGTCCAAACAGGGAGAAAAGATGGGCTAGTTTCGTCGGCAGATATAGCCAA
TGTGACACTCCCCGGACCTTCCATTACAGTCCCGCAGGCCGTTGCCGCATTTGCTGACAAGGGTCTCACCGCTGTTGACATGGTTCTCCTTCTAG
AGGTACGTACCACACTACAAAGGCC
ATGTTTTCCGCCTTTTGAACCGAATTTGGAGCCATATCCTGGACCCGACCGATTTCCGTCGGATTTGGCGGCTCGGTTCTACTTAATTCCCCTTCCGCTGGAAAGATAGGGAATTGCCAA
ATCCAGCGCACTTGGTCTTGAATAAGGATTCCAGCAGATTTGGAAATTCCAGTGGAATTAGACGTTTGGAAGCGGAAAATGTGACCTAAGTAAATTCAATCACTAGGATTCAGGGGTCCT
TTCGCTTCAATGTTTTCAGTATAGGTTTTTGCGGCAGATTTAGGGCTGGAATTATTGGTCGCCGGTCGGATTGAGGGCTTAATTCCAGACGCCTAATTAGTTCTGTCAGATACATTTTTC
ACGGCCAGAAAGCGACATTGCCCAAGTCAGCCGGAGTGTAGGGCATACTTCCATATAGTTCCAGCCTCCGAAATCTGTTTGGAGTGGCAAAATTTTCCCTGAATCCGAATTCCAGCAACT
TTAGGAATTCCAACTGAAATTGACAGTCTTTGAGCTAAAAATACCTTCCTTTTACTACCATTCAACTGATAAGTACTATTTGATGCCAAACTGCAACAGGAGCTCATTCAGTTGGAGTAG
CACACTGCTCATTCCTGGACGAACGTATCCACAATTTCAGGGGCAGCGGCAGACCCGACCCGTCAATGGACCAATTCACGGCCAATACCTTGAGATCAAGGTGCCCCATCAACTCAATCG
AGAACACAGTCAACCTTGACCAGAATCCCTTCAGCCCATTTGTGTTGGACAATTCGTACTACCAGAACATACTGCTGCGGCGAGGGGTTCTCCAGATTGACCAGGAGCTTGGAATGAACA
GATTCACACGTCCAATAGTTGCCAATTTGGCCGGTGCTATCGACTTTCCGGCTCGGTTTGGTGCGGCTATGGTCCGCCTAGGGGCTGTTGGTGTTCTTACGGGGACTCAGGGTGAGGTTA
GGAGGTCTTGCAGAGTGGTTAACAAAGTTGTTAGTAAAGATGAATCTGGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGACCAAGGAGACGGCCATTGCTGGGTTTATGGTGGGGCTGCTACTACTCTCAGGAGATCCGTTGATTTGCTACGGTGCACTCCAAGTAGGATTTTACAGAGGGAAATGTGGCTTC
GCTGACGTGGAAGCCATCGTCGGCGGCCTCGTTTCCTCTCATCTCTTTAGAGACCCTTCCATCCTCGCTTCCCTTATCCGCCTCCATTTCCATGATTGTTTCGTCAAT
GGCTGTGATGCA
TCCATTCTCCTGGACGGTCCAGACACCGAGAAAACCGCATCACCCAACCACAGTGTCAGAGGTTACGAGATTATCGACCAGGCTAAGGCCGCCGTCGACAAAATCTGCCCTGGTGTCGTT
TCTTGTGCTGACCTCATTGCCATTGCCGCCCGCGACGCTGTTTTCCTC
AGTGGAGGAGGTATATACAGAGTCCAAACAGGGAGAAAAGATGGGCTAGTTTCGTCGGCAGATATAGCCAAT
GTGACACTCCCCGGACCTTCCATTACAGTCCCGCAGGCCGTTGCCGCATTTGCTGACAAGGGTCTCACCGCTGTTGACATGGTTCTCCTTCTAG
GAGCTCATTCAGTTGGAGTAGCACAC
TGCTCATTCCTGGACGAACGTATCCACAATTTCAGGGGCAGCGGCAGACCCGACCCGTCAATGGACCAATTCACGGCCAATACCTTGAGATCAAGGTGCCCCATCAACTCAATCGAGAAC
ACAGTCAACCTTGACCAGAATCCCTTCAGCCCATTTGTGTTGGACAATTCGTACTACCAGAACATACTGCTGCGGCGAGGGGTTCTCCAGATTGACCAGGAGCTTGGAATGAACAGATTC
ACACGTCCAATAGTTGCCAATTTGGCCGGTGCTATCGACTTTCCGGCTCGGTTTGGTGCGGCTATGGTCCGCCTAGGGGCTGTTGGTGTTCTTACGGGGACTCAGGGTGAGGTTAGGAGG
TCTTGCAGAGTGGTTAACAAAGTTGTTAGTAAAGATGAATCTGGCTAG

Retrieve as FASTA