Entry information : LuPrx25(Lus10004804|PACid:23178692)
Entry ID 12146
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx25(Lus10004804|PACid:23178692)
Name LuPrx25(Lus10004804|PACid:23178692)
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx25
start..stop
S start..stop
LuPrx136 498 1.12e-178 32..346 32..348
PtPrx37 488 4.83e-175 20..344 15..336
JcPrx01 467 1.49e-166 19..346 10..334
RcPrx14 456 4.05e-162 2..346 1..339
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12146' 'complement(join(94354..94811,94904..95243,95313..95576))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 95313..95576 262 N° 2 94904..95243 338 N° 3 94354..94811 456  
complement(join(94354..94811,94904..95243,95313..95576))


exon

Literature and cross-references LuPrx25(Lus10004804|PACid:23178692)
DNA ref. Phytozome 12:   scaffold487 (95576..94354)
Protein sequence: LuPrx25(Lus10004804|PACid:23178692)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (322)
PWM (Da):   %s   39404.87 (35962.2) Transmb domain:   %s   i7-25o
PI (pH):   %s   8.98 (9.13) Peptide Signal:   %s   cut: 32 range:32-353
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMSRKTTMISWAAAMAAAVLMMMLVEEGVEAAIGLQQPLKLKWHYYRRETSCKYAEEFVKHQVKLFWNRDQTITAKLLRLLYSDCFVTGCDASVLLDGADSEKTAPQNTRLDGFELIDRI
KKVMEIRCPGVVSCADILNLATRDAVHLAGGPSYPVLTGRMDGFLSAASTVDLPSPSISANAALAYFQSRGLDVLDMATLLGAHSIGTTDCRYIVDRLYNFKTTKKADPSMNMQLADQLR
KRCPPLSNTYTANSSRVFLNPDSAHSYQLSNSYYKRALSYQSVLGVDQQLLYTNDTLQITQEFSRADGFENWRRSVALSMARMGNINVLTGNAGEIRRNCRYTNTKLSLRIST*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGTAGGAAGACAACAATGATTTCATGGGCGGCAGCCATGGCAGCAGCGGTGCTGATGATGATGTTGGTGGAGGAAGGAGTGGAGGCGGCGATCGGGCTGCAGCAGCCGTTGAAG
CTAAAGTGGCATTACTACCGTAGGGAAACGAGTTGCAAGTACGCAGAGGAGTTTGTGAAGCACCAGGTTAAGCTGTTTTGGAACAGAGATCAAACAATCACCGCTAAGCTCCTACGTTTG
CTCTACTCTGACTGCTTCGTCACC
GTACGTGTACTAGCAGTCTAAGTCATTCATTTATTCATTCATTCAATATTCATCTGTGTGACATGACAGGGGGGTGCGATGCATCAGTACTGCTGG
ATGGGGCTGATTCAGAGAAAACAGCACCTCAGAACACAAGGCTAGATGGGTTTGAACTTATAGATAGGATCAAAAAAGTGATGGAGATAAGGTGCCCAGGCGTTGTCTCGTGTGCAGACA
TCCTCAACCTTGCAACTAGAGATGCAGTTCACTTGGCAGGAGGTCCATCATATCCAGTGTTGACTGGTAGAATGGACGGTTTTCTATCGGCCGCATCCACCGTCGATCTCCCATCACCTT
CCATCTCTGCCAATGCTGCATTGGCTTATTTCCAATCCAGAGGATTGGATGTTCTAGACATGGCCACTCTTTTAG
GTATTCACACAACAACAACCACCTTCATCAAATTCACATCCATCA
CACCAATTTGCTATATATCAACAAGCTTTTATTATTAATTAATGCAGGTGTGCCCACTCCATTGGTACGACCGACTGTCGCTACATCGTCGATCGGCTTTACAACTTCAAAACCACAAAG
AAGGCAGACCCCAGTATGAACATGCAATTGGCTGACCAACTCAGGAAGAGATGCCCTCCTCTATCAAACACTTACACCGCCAACTCCTCGAGGGTTTTTTTGAACCCAGATTCTGCACAT
TCCTACCAGCTCAGCAACTCCTACTACAAGAGGGCCTTGTCTTACCAATCCGTTCTAGGTGTCGACCAGCAGCTACTCTACACTAATGACACCCTACAAATCACCCAAGAATTTTCCCGG
GCTGACGGCTTTGAAAACTGGAGAAGATCTGTTGCCCTCTCCATGGCTAGGATGGGCAACATCAATGTCTTAACAGGGAATGCAGGGGAGATACGTAGGAATTGCAGATACACCAACACT
AAACTAAGTCTTCGCATCTCAACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGTAGGAAGACAACAATGATTTCATGGGCGGCAGCCATGGCAGCAGCGGTGCTGATGATGATGTTGGTGGAGGAAGGAGTGGAGGCGGCGATCGGGCTGCAGCAGCCGTTGAAG
CTAAAGTGGCATTACTACCGTAGGGAAACGAGTTGCAAGTACGCAGAGGAGTTTGTGAAGCACCAGGTTAAGCTGTTTTGGAACAGAGATCAAACAATCACCGCTAAGCTCCTACGTTTG
CTCTACTCTGACTGCTTCGTCACC
GGGTGCGATGCATCAGTACTGCTGGATGGGGCTGATTCAGAGAAAACAGCACCTCAGAACACAAGGCTAGATGGGTTTGAACTTATAGATAGGATC
AAAAAAGTGATGGAGATAAGGTGCCCAGGCGTTGTCTCGTGTGCAGACATCCTCAACCTTGCAACTAGAGATGCAGTTCACTTGGCAGGAGGTCCATCATATCCAGTGTTGACTGGTAGA
ATGGACGGTTTTCTATCGGCCGCATCCACCGTCGATCTCCCATCACCTTCCATCTCTGCCAATGCTGCATTGGCTTATTTCCAATCCAGAGGATTGGATGTTCTAGACATGGCCACTCTT
TTAG
GTGCCCACTCCATTGGTACGACCGACTGTCGCTACATCGTCGATCGGCTTTACAACTTCAAAACCACAAAGAAGGCAGACCCCAGTATGAACATGCAATTGGCTGACCAACTCAGG
AAGAGATGCCCTCCTCTATCAAACACTTACACCGCCAACTCCTCGAGGGTTTTTTTGAACCCAGATTCTGCACATTCCTACCAGCTCAGCAACTCCTACTACAAGAGGGCCTTGTCTTAC
CAATCCGTTCTAGGTGTCGACCAGCAGCTACTCTACACTAATGACACCCTACAAATCACCCAAGAATTTTCCCGGGCTGACGGCTTTGAAAACTGGAGAAGATCTGTTGCCCTCTCCATG
GCTAGGATGGGCAACATCAATGTCTTAACAGGGAATGCAGGGGAGATACGTAGGAATTGCAGATACACCAACACTAAACTAAGTCTTCGCATCTCAACATGA

Retrieve as FASTA