1. Browse the Database
  2. View Redoxidase
Entry information : LuPrx27(Lus10005278|PACid:23175320)
Entry ID 12148
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx27(Lus10005278|PACid:23175320)
Name LuPrx27(Lus10005278|PACid:23175320)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx27
start..stop		 S start..stop
LuPrx78 650 0 1..344 1..344
RcPrx49 503 1.35e-180 11..342 16..351
CppPrx08 500 1.3e-179 16..342 22..352
MePrx10 499 1.61e-179 11..342 18..346
Gene structure Fichier Exons►


exon

Literature and cross-references LuPrx27(Lus10005278|PACid:23175320)
DNA ref. Phytozome 12:   scaffold109 (87733..89683)
Protein sequence: LuPrx27(Lus10005278|PACid:23175320)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (314)
PWM (Da):   %s   37810.37 (34636.6) Transmb domain:   %s   o10-32i
PI (pH):   %s   9.57 (9.60) Peptide Signal:   %s   cut: 31 range:31-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAILPHSPSTFLYISLIILLLLHISSATGAATNRRRPRQLSVNYY
ARTCPHLEQLVGSVTSQQFKVSPVSGAATIRLFFHDCFVQGCDGSILMSTKPGSRELAEKEAEDNKDLRAEGYDTVFKAKSLVETKCPGAVSCSDILAIAARDYVHLTGGPYYQVKKGRFDGKTSKATTVPGNIPRPNSTVDALFTLFRTKGLSLQDMVV
LSGAHTIGFAHCKQFVSRLYDYKGTKNPDPTLDPRLLKELRMSCPRVGSNDGVVVPFDVTTPFMFDHAYYLNLEGRLGLLGSDQGLWMDPRTKGVVQEMGRDRGKFLGMFGLAMEKMGDI
GVKRGRRHGEIRKDCSMVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction. Extra 3'.
DNA ►
Send to BLAST
CDS►
Send to BLAST