Entry information : LuPrx31(Lus10006534|PACid:23149200)
Entry ID 12151
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx31(Lus10006534|PACid:23149200)
Name LuPrx31(Lus10006534|PACid:23149200)
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx31
start..stop
S start..stop
LuPrx07 619 0 1..316 1..316
EcamPrx191 470 9e-169 10..322 7..317
EguPrx191 469 2e-168 10..322 7..317
PpePrx28 469 3e-168 1..322 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3168..3389 222 N° 2 2866..3057 192 N° 3 2232..2786 555  
complement(join(2232..2786,2866..3057,3168..3389))


exon

Literature and cross-references LuPrx31(Lus10006534|PACid:23149200)
DNA ref. Phytozome 12:   scaffold1202 (3389..2232)
Protein sequence: LuPrx31(Lus10006534|PACid:23149200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   34389.07 (31916.8)  
PI (pH):   %s   7.98 (7.68) Peptide Signal:   %s   cut: 23 range:23-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYPSVKSLFVTFFIIGSSVLASTSNAQLAGNFYARTCPNVQGIVNRAMSEAVNREPRLGASILRLFFHDCFVNGCDGSILLDDTSTFTGEKNANPNRNSVRGFEVIDTIKTRVESACNATVSCADLLAIAARDGVVLLGGPSWQVLLGRRDARTASQSDANNDLPSPFSDLPALISSFTNKGLTAADMTVLSGGHTIGQARCTTFRNRIYNETNIGPNFAANRRANCPSAAGTGDGNLAPLDLSPNSFDNAYYTELVGQRGLLHSDQQLFSGGSQDALVRTYSTNVNAFGRDFANAMIKMGNLSPLTGSNGEIRRNCRLIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATCCCTCTGTTAAGTCCTTGTTTGTAACCTTCTTCATTATTGGGTCGTCTGTGCTAGCTTCAACCAGTAACGCCCAACTCGCTGGGAACTTCTACGCTCGAACATGCCCTAAC
GTTCAGGGCATAGTTAATCGTGCAATGAGTGAAGCTGTTAATAGAGAGCCCCGCCTCGGTGCATCTATCCTTCGTTTGTTCTTCCATGATTGTTTCGTCAAT
GTAAGTTTTGATAAAAAC
AATACCATTGAGTTTAATACATTCTTGTGCATAAAATGTTTGGCACCAAATTTCTAATGTTCATAAGGTTGCCTCTTCTTTTTGTTTGCTAGGGATGTGACGGGTCTATTTTGCTAGACG
ATACGTCGACATTTACAGGGGAGAAGAACGCGAATCCTAACCGGAACTCAGTTCGAGGGTTTGAGGTCATTGACACCATCAAAACCAGAGTTGAAAGTGCTTGCAATGCTACTGTGTCTT
GTGCAGATCTCCTTGCAATTGCTGCAAGAGACGGTGTCGTATTG
GTAATTCTCTTTTCTTCACTTGCTCATTAAGATCTACCAATTTACCAACGTAACTATCTGATCAAATTTTTGCATG
CAGCTTGGTGGCCCATCGTGGCAAGTCTTATTGGGCCGGAGAGACGCAAGAACAGCCAGCCAAAGTGACGCCAACAATGATCTCCCCTCCCCATTCTCCGACCTTCCAGCCCTAATCTCA
TCCTTTACCAACAAGGGCCTAACAGCCGCCGACATGACCGTCCTCTCCGGCGGCCACACCATCGGCCAAGCCAGGTGCACCACTTTTCGCAACCGAATCTACAATGAGACCAACATCGGC
CCCAACTTTGCTGCCAACAGAAGGGCCAACTGCCCCTCCGCTGCCGGCACGGGCGACGGGAACTTGGCCCCACTCGACTTGTCTCCGAATAGTTTCGACAATGCTTATTATACGGAGCTC
GTGGGTCAGCGTGGGCTGCTTCATTCCGACCAGCAGCTATTCAGCGGTGGGTCCCAGGATGCTTTGGTCAGGACTTATAGTACTAATGTCAACGCATTTGGTAGGGATTTTGCAAATGCC
ATGATTAAGATGGGGAATCTTAGTCCTCTCACGGGAAGTAATGGCGAGATTAGGCGTAATTGCAGGCTTATAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATCCCTCTGTTAAGTCCTTGTTTGTAACCTTCTTCATTATTGGGTCGTCTGTGCTAGCTTCAACCAGTAACGCCCAACTCGCTGGGAACTTCTACGCTCGAACATGCCCTAAC
GTTCAGGGCATAGTTAATCGTGCAATGAGTGAAGCTGTTAATAGAGAGCCCCGCCTCGGTGCATCTATCCTTCGTTTGTTCTTCCATGATTGTTTCGTCAAT
GGATGTGACGGGTCTATT
TTGCTAGACGATACGTCGACATTTACAGGGGAGAAGAACGCGAATCCTAACCGGAACTCAGTTCGAGGGTTTGAGGTCATTGACACCATCAAAACCAGAGTTGAAAGTGCTTGCAATGCT
ACTGTGTCTTGTGCAGATCTCCTTGCAATTGCTGCAAGAGACGGTGTCGTATTG
CTTGGTGGCCCATCGTGGCAAGTCTTATTGGGCCGGAGAGACGCAAGAACAGCCAGCCAAAGTGAC
GCCAACAATGATCTCCCCTCCCCATTCTCCGACCTTCCAGCCCTAATCTCATCCTTTACCAACAAGGGCCTAACAGCCGCCGACATGACCGTCCTCTCCGGCGGCCACACCATCGGCCAA
GCCAGGTGCACCACTTTTCGCAACCGAATCTACAATGAGACCAACATCGGCCCCAACTTTGCTGCCAACAGAAGGGCCAACTGCCCCTCCGCTGCCGGCACGGGCGACGGGAACTTGGCC
CCACTCGACTTGTCTCCGAATAGTTTCGACAATGCTTATTATACGGAGCTCGTGGGTCAGCGTGGGCTGCTTCATTCCGACCAGCAGCTATTCAGCGGTGGGTCCCAGGATGCTTTGGTC
AGGACTTATAGTACTAATGTCAACGCATTTGGTAGGGATTTTGCAAATGCCATGATTAAGATGGGGAATCTTAGTCCTCTCACGGGAAGTAATGGCGAGATTAGGCGTAATTGCAGGCTT
ATAAATTAA

Retrieve as FASTA