Entry information : LuPrx33(Lus10006756|PACid:23163559)
Entry ID 12153
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx33(Lus10006756|PACid:23163559)
Name LuPrx33(Lus10006756|PACid:23163559)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx33
start..stop
S start..stop
LuPrx99 480 2e-172 3..324 2..324
LuPrx39 475 1e-170 20..324 21..325
MePrx97 439 3e-156 1..324 1..328
MePrx110 439 3e-156 1..324 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150972..151184 213 N° 2 150713..150901 189 N° 3 149405..149980 576  
complement(join(149405..149980,150713..150901,150972..151184))


exon

Literature and cross-references LuPrx33(Lus10006756|PACid:23163559)
DNA ref. Phytozome 12:   scaffold204 (151184..149405)
Protein sequence: LuPrx33(Lus10006756|PACid:23163559)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (303)
PWM (Da):   %s   35542.18 (33119.9)  
PI (pH):   %s   7.67 (7.36) Peptide Signal:   %s   cut: 23 range:23-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASKGLLALLLLQICFTFTSANPLLKVGYYAKTCPNAEAIVKEVTDKVMYVAPSLSGPLLRMHFHDCFIRGCDASVLIDSTKHIPAEKDAFPNLSLRGFGVVNRVKAALEMECPGIVSCSDILAIVARDVTVATKGLRWEVETGRKDGRISIMNEALFGLIPQSANISFLISSFKALGLSIKDLVVLQGSHTIGISHCSSFTNRIYNFTGNDDVDPTLDSEYIPNLRRKCRTATDQTTVVEMDPGSFKTFDNGYFKLVAKRRALFPSDAALMDNEETKAYVEKSLTSGSTFLKDFGDSMVKMGRIGVLTGDAGEIREVCYKINE*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCCAAGGGCTTGTTGGCTCTGTTACTCCTCCAAATTTGCTTCACCTTTACGTCCGCAAATCCACTACTGAAAGTGGGTTACTACGCAAAAACATGCCCAAATGCTGAGGCA
ATTGTCAAGGAGGTTACTGATAAAGTCATGTACGTGGCTCCTAGCCTCAGCGGTCCTTTGCTCAGGATGCACTTCCACGATTGCTTCATTCGG
GTAATTACCATAGTGTTTATACTAATC
TAATCACGATCGAATTTCTTACGGTTTGATCTATATATGGCAGGGATGTGACGCTTCGGTTTTGATAGATTCGACAAAACACATCCCAGCTGAAAAGGACGCGTTCCCGAATCTCAGCCT
TAGAGGGTTTGGAGTCGTCAACCGAGTAAAGGCAGCCCTCGAGATGGAGTGTCCGGGCATCGTCTCGTGCTCCGATATCCTAGCAATCGTAGCTAGGGATGTTACAGTCGCG
GTATGTAA
TTACTTAAAACCAATTTTTTTTTTTCATATATGGCTACAATTTTCTAAGATTATGATCCACATTCACTTTTAAGAAACCAAGCATCGATAAGTGATGATGAACATAGCTTTTAAAGATAC
CGCTACGGTGCCCCGCACTAAAAGTGCAATACTGACGGTTTAATGAACTCATTTTCTTCTGTATATCATAAAAGGATAAATCCAATGCTTTGAGGAAAGGTAATTCGATAGAGATGATGA
TTTATCATTTTAGTTAAAAATGCATCGCCAAAAAGAAACTTGAAGAACATCGACGAAAAACTTCAACAAGGTTTAATGTCTGACTTAATAAGATTACTTAATATATTGATTTCAATTAAT
CAAAAAGACCGCTCTAGATAGCATTTTTAACTAAGAATGTTCCATCTATACAAAGAAACTAAATAAAGTAAAAACAACAAACGACATCGTTCCCTCTTAAGCTAATTAATTCCAAAGGAT
GCTTGCCCTCTTCTTTCATCAACATGAACATTTGCCAATTGCAGAAGCACGGTGCTACTGTTCCTCTTCTCCATGATCTTCACTTGTGCACACAAAGCTTCGAAAAGACTATGTATTCTT
TCATTATGCTTCACCACATCCCATCAAAAATCCGAAATTTAGACATATTTGAGCGAAATAGTAATAAGACGAACGATTTTTCGGAGGAAAAACTATGCATAACAATGTGTACGTACAAAT
GCAGACGAAAGGGCTACGATGGGAAGTGGAGACGGGTCGAAAAGACGGAAGGATATCGATCATGAACGAGGCGCTATTCGGCCTAATCCCACAGTCGGCGAACATCTCCTTCTTGATCTC
AAGCTTCAAAGCTCTCGGACTTTCCATCAAGGACTTGGTTGTGCTACAAGGAAGCCACACCATAGGAATCTCCCATTGCTCTTCCTTCACCAACAGAATCTACAACTTCACAGGAAACGA
CGACGTGGACCCTACCCTGGACTCCGAGTATATACCCAACCTGAGACGGAAATGTAGAACGGCGACGGATCAGACGACGGTGGTGGAAATGGACCCTGGAAGCTTCAAGACATTTGACAA
TGGGTACTTCAAGCTTGTCGCCAAAAGGAGGGCTCTGTTCCCGTCAGACGCGGCCTTGATGGACAACGAAGAGACTAAGGCTTATGTCGAGAAGTCGCTGACCTCTGGATCGACTTTCTT
GAAGGACTTTGGCGATTCCATGGTTAAGATGGGGAGGATCGGCGTCCTAACCGGGGATGCCGGTGAGATCAGGGAAGTTTGTTACAAGATTAATGAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCCAAGGGCTTGTTGGCTCTGTTACTCCTCCAAATTTGCTTCACCTTTACGTCCGCAAATCCACTACTGAAAGTGGGTTACTACGCAAAAACATGCCCAAATGCTGAGGCA
ATTGTCAAGGAGGTTACTGATAAAGTCATGTACGTGGCTCCTAGCCTCAGCGGTCCTTTGCTCAGGATGCACTTCCACGATTGCTTCATTCGG
GGATGTGACGCTTCGGTTTTGATAGAT
TCGACAAAACACATCCCAGCTGAAAAGGACGCGTTCCCGAATCTCAGCCTTAGAGGGTTTGGAGTCGTCAACCGAGTAAAGGCAGCCCTCGAGATGGAGTGTCCGGGCATCGTCTCGTGC
TCCGATATCCTAGCAATCGTAGCTAGGGATGTTACAGTCGCG
ACGAAAGGGCTACGATGGGAAGTGGAGACGGGTCGAAAAGACGGAAGGATATCGATCATGAACGAGGCGCTATTCGGC
CTAATCCCACAGTCGGCGAACATCTCCTTCTTGATCTCAAGCTTCAAAGCTCTCGGACTTTCCATCAAGGACTTGGTTGTGCTACAAGGAAGCCACACCATAGGAATCTCCCATTGCTCT
TCCTTCACCAACAGAATCTACAACTTCACAGGAAACGACGACGTGGACCCTACCCTGGACTCCGAGTATATACCCAACCTGAGACGGAAATGTAGAACGGCGACGGATCAGACGACGGTG
GTGGAAATGGACCCTGGAAGCTTCAAGACATTTGACAATGGGTACTTCAAGCTTGTCGCCAAAAGGAGGGCTCTGTTCCCGTCAGACGCGGCCTTGATGGACAACGAAGAGACTAAGGCT
TATGTCGAGAAGTCGCTGACCTCTGGATCGACTTTCTTGAAGGACTTTGGCGATTCCATGGTTAAGATGGGGAGGATCGGCGTCCTAACCGGGGATGCCGGTGAGATCAGGGAAGTTTGT
TACAAGATTAATGAATGA

Retrieve as FASTA