Entry information : LuPrx35(Lus10007050|PACid:23153238)
Entry ID 12155
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx35(Lus10007050|PACid:23153238)
Name LuPrx35(Lus10007050|PACid:23153238)
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx35
start..stop
S start..stop
LuPrx111 434 6.44e-157 1..246 1..255
LuPrx36 380 3.24e-134 48..246 128..324
LuPrx36 90 3.01e-21 7..59 1..53
LuPrx37 370 1.76e-130 48..246 128..325
LuPrx37 86 6.53e-20 7..59 1..53
LuPrx112 322 5.12e-112 7..246 4..279
Gene structure Fichier Exons


exon

Literature and cross-references LuPrx35(Lus10007050|PACid:23153238)
DNA ref. Phytozome 12:   scaffold772 (1914..681)
Protein sequence: LuPrx35(Lus10007050|PACid:23153238)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   245 (218)
PWM (Da):   %s   26283.29 (23188.7)  
PI (pH):   %s   10.48 (10.36) Peptide Signal:   %s   cut: 28 range:28-245
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKIVGMSTLFVVWLVMFLANRSAVDAQGTRVGFYSTSCPRAESIVRATTSGPSWTVPTGRRDGRVSLASDTTNLPAFNDSAAVQISKYTQKGLNTQDLVALSGAHTNASARPACAVFRY
RLYKCPGSASGADPTLDPAFVPQLRAVCPQNGNAARRVAMDTGSPNRFDNSYYANLRSGRTVLESDSVLWTDAGTRVMAQRFLGIRGLAGLTFAVEFARSMVRMGNIEIKSGAQGEIRRV
CSAVN*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. PS is missing.
DNA
Send to BLAST
CDS
Send to BLAST