Entry information : LuPrx37(Lus10007052|PACid:23153232)
Entry ID 12157
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx37(Lus10007052|PACid:23153232)
Name LuPrx37(Lus10007052|PACid:23153232)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx37
start..stop
S start..stop
LuPrx36 643 0 1..325 1..324
RcPrx54 482 3.69e-173 1..324 3..324
CsPrx44 476 1e-170 1..325 1..326
CclPrx41 476 1.03e-170 1..324 1..325
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12157' 'join(12857..13243,13337..13499,13601..14025)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12857..13243 385 N° 2 13337..13499 161 N° 3 13601..14025 423  
join(12857..13243,13337..13499,13601..14025)


exon

Literature and cross-references LuPrx37(Lus10007052|PACid:23153232)
DNA ref. Phytozome 12:   scaffold772 (12857..14025)
Protein sequence: LuPrx37(Lus10007052|PACid:23153232)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   34639.3 (32174.0)  
PI (pH):   %s   7.99 (7.99) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTLFVFWLVMVLANRSAVDAQGTRVGFYSTSCPRAESIVRATVQSHFNSDPTIAPGILRMHFHDCFVHGCDGSILLDGANAEKTAVPNLQLRGYDVIDDAKTQIEAACPGVVSCADILA
LAARDSVAVTSGPSWTVPTGRRDGRVSLASDTTNLPAFNDSAAVQITKYTQKGLNTQDLVALSGAHTIGTAACAVFRYRLYNFPGSASGADPTLDPAFVPQLRAVCPQNGNAARRVAMDT
GSPNRFDNSYYDNLRSRGRTVLESDSVLWTDAGTRVMAQRFLGIRGLAGLTFAVEFGRSMVRMGNIEINSGAQGEIRRVCSAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACGTTGTTTGTGTTTTGGCTTGTGATGGTTCTGGCCAACAGGTCCGCAGTTGATGCCCAAGGGACTCGGGTAGGATTCTATTCCACTTCATGTCCACGAGCCGAGTCGATTGTT
CGAGCAACGGTCCAGTCACATTTCAACTCCGACCCCACCATTGCCCCTGGCATACTGAGGATGCACTTCCATGACTGTTTCGTCCATGGATGCGACGGTTCCATCCTCCTCGATGGCGCC
AACGCTGAGAAAACGGCAGTTCCCAATCTCCAGCTCCGAGGCTACGATGTGATTGACGATGCCAAAACCCAGATCGAAGCAGCTTGCCCTGGCGTCGTTTCTTGCGCCGACATCCTAGCT
CTTGCTGCCCGCGACTCTGTTGCCGTG
TGGTAAGTAATTAGATTGTTATTCTTCAAATTATAAATCATTACTGTGATTAATTAATTTGTTTGTAACTGTGCTTTTGATTTTGCGGTATAC
AGACAAGTGGGCCAAGCTGGACGGTGCCGACAGGGAGGAGAGACGGGAGGGTGTCACTGGCATCGGACACTACTAATTTGCCGGCGTTCAATGACTCGGCCGCAGTTCAAATTACCAAGT
ACACACAGAAAGGACTCAACACTCAGGATCTTGTTGCTCTCTCTG
TGGTACGTATGTGGACAATTAATAGAATTAAAACCAAGTGATTAATCTAATTCATTATCAACTAATTAATTAATT
ATCTACTCGGATGATGTTTGACTTACAGGGGCCCACACAATAGGAACGGCAGCCTGCGCGGTATTCCGGTACAGGCTGTACAACTTCCCGGGCTCTGCTTCCGGCGCCGACCCAACGCTC
GACCCGGCATTTGTTCCCCAACTGAGGGCGGTCTGCCCACAGAACGGAAATGCGGCAAGGAGGGTGGCTATGGACACTGGAAGCCCTAACCGATTCGATAATTCATACTATGATAACTTG
AGGAGCCGCGGCCGGACTGTTTTGGAATCGGACTCTGTTCTGTGGACGGATGCCGGGACCAGAGTGATGGCACAGAGGTTCCTCGGGATCAGAGGATTGGCCGGGTTGACGTTCGCTGTG
GAGTTTGGAAGATCGATGGTGAGGATGGGGAATATCGAGATCAATAGCGGCGCCCAGGGTGAGATCCGGCGAGTCTGCTCCGCCGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACGTTGTTTGTGTTTTGGCTTGTGATGGTTCTGGCCAACAGGTCCGCAGTTGATGCCCAAGGGACTCGGGTAGGATTCTATTCCACTTCATGTCCACGAGCCGAGTCGATTGTT
CGAGCAACGGTCCAGTCACATTTCAACTCCGACCCCACCATTGCCCCTGGCATACTGAGGATGCACTTCCATGACTGTTTCGTCCATGGATGCGACGGTTCCATCCTCCTCGATGGCGCC
AACGCTGAGAAAACGGCAGTTCCCAATCTCCAGCTCCGAGGCTACGATGTGATTGACGATGCCAAAACCCAGATCGAAGCAGCTTGCCCTGGCGTCGTTTCTTGCGCCGACATCCTAGCT
CTTGCTGCCCGCGACTCTGTTGCCGTG
ACAAGTGGGCCAAGCTGGACGGTGCCGACAGGGAGGAGAGACGGGAGGGTGTCACTGGCATCGGACACTACTAATTTGCCGGCGTTCAATGAC
TCGGCCGCAGTTCAAATTACCAAGTACACACAGAAAGGACTCAACACTCAGGATCTTGTTGCTCTCTCTG
GGGCCCACACAATAGGAACGGCAGCCTGCGCGGTATTCCGGTACAGGCTG
TACAACTTCCCGGGCTCTGCTTCCGGCGCCGACCCAACGCTCGACCCGGCATTTGTTCCCCAACTGAGGGCGGTCTGCCCACAGAACGGAAATGCGGCAAGGAGGGTGGCTATGGACACT
GGAAGCCCTAACCGATTCGATAATTCATACTATGATAACTTGAGGAGCCGCGGCCGGACTGTTTTGGAATCGGACTCTGTTCTGTGGACGGATGCCGGGACCAGAGTGATGGCACAGAGG
TTCCTCGGGATCAGAGGATTGGCCGGGTTGACGTTCGCTGTGGAGTTTGGAAGATCGATGGTGAGGATGGGGAATATCGAGATCAATAGCGGCGCCCAGGGTGAGATCCGGCGAGTCTGC
TCCGCCGTCAACTGA

Retrieve as FASTA