Entry information : LuPrx43(Lus10008168|PACid:23173770)
Entry ID 12160
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx43(Lus10008168|PACid:23173770)
Name LuPrx43(Lus10008168|PACid:23173770)
Class Class III peroxidase    [Orthogroup: Prx121]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx43
start..stop
S start..stop
LuPrx151 521 0 5..358 13..360
LuPrx149 517 0 6..358 7..354
LuPrx42 514 0 11..358 17..372
LuPrx01 491 9e-176 3..330 11..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 94518..94919 402 N° 2 95452..95620 169 N° 3 95713..96218 506  
join(94518..94919,95452..95620,95713..96218)


exon

Literature and cross-references LuPrx43(Lus10008168|PACid:23173770)
DNA ref. Phytozome 12:   scaffold480 (94518..96218)
Protein sequence: LuPrx43(Lus10008168|PACid:23173770)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (337)
PWM (Da):   %s   37750.71 (35554.5)  
PI (pH):   %s   4.2 (4.24) Peptide Signal:   %s   cut: 22 range:22-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVLSLVATLLMLLSIGVSNAQLTPTFYNTTCPEVTNIVRQVLQNFAFTDPRIGASLIRLHFHDCFVTGCDASVLLDNNANAMIESEKQAAPNNGSLRGFEVVDAMKSQIEAVCPGVVSCADILSIASEESVVLAGGPSWAVPLGRLDSVAANRTLANSALPPPFFTVDQLKAMFAAVGLNTTVDLVALSGAHTFGRAQCGNFVNRLYNFNGTGSPDPTVNATYLQTLQQLCPQNGSVAVLANLDRSTADGFDSTYFTNLQTQEGLLESDQALFSTPNSDTIALVNTFSANQTAFFESFVNSMIRMGNIPPPAGSAGEIRLNCRVINPAASGTAVITTPAGFVDVDGGEEMNRFASDI*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGTCTTGTCTTTGGTTGCCACATTGTTGATGCTGTTGAGCATTGGAGTGAGCAATGCACAGCTGACACCAACGTTCTACAACACGACGTGCCCCGAAGTGACCAACATCGTCCGT
CAAGTTCTTCAGAATTTCGCATTCACCGACCCTAGAATCGGGGCCAGCCTTATCAGGCTTCACTTCCACGATTGCTTTGTTACGGGGTGCGACGCATCGGTCCTGCTGGACAACAATGCG
AATGCGATGATCGAGAGCGAGAAGCAAGCGGCTCCGAATAACGGATCCTTGAGAGGGTTCGAAGTCGTTGATGCGATGAAGAGCCAGATCGAAGCTGTTTGCCCCGGAGTTGTTTCTTGT
GCCGATATTCTCAGCATTGCTTCTGAAGAATCTGTTGTCTTG
GTACGTAATATTTTTAACCAAGACAAACTTATCGCATGTGATTCATATAAAATGGTTAAATTGATTTTCTCTTAATTA
ATTTCGATTGGTCTTTGATAATTTCTTAAAACACATGGCAACTTGTCTATAAGCTACTTTGCAAATGCAAAGCTAATTGGAATTTGTTTTTTTAAGTAAGCTCACTGGTGCTTTCTGTCT
ACTAGCTAAGAAATGTTGGCAAAGAATATAGTCCATACTTGACGAATTTTTTAACAATTTGACGGAATTCGGATTGAAATGTAATCAGCAATTCCATTTTTTTATTTGGAATTCGGTGGA
ATTAACCCTTCAAATTCGGAAAATTGATCATGTCTTTTTATGAGAGCATAGAACGTATCATACATAATTGATTGGCGTCCAAAATTGGGCCGAATTCCAAGCCAATTTTGCCTCCAATTC
CTGTGCGGAAAACGTTACCATAGTTTTGAGTCACCGTGAATTTTATTTTCCTTTATTTGATTTTTATTTTTTTTGGTGGAATTATTGTACGTAGGCTGGAGGGCCATCATGGGCAGTTCC
GTTGGGAAGGCTGGATAGCGTAGCTGCAAACAGGACATTAGCAAATTCAGCACTTCCACCTCCGTTTTTCACCGTCGATCAGCTGAAAGCTATGTTCGCCGCCGTAGGCCTCAACACCAC
CGTAGACCTCGTTGCTCTCTCGG
GTAACCTTTGAAGTTTGATCACACACTCGTAGAAAACAGATCAGAATTCATTATTTATTTCTTAACTTTATTGGATGGACATGGGCCTACAGGAGCG
CACACTTTCGGAAGGGCCCAATGCGGAAACTTCGTAAACAGGCTTTACAACTTCAACGGCACAGGAAGCCCAGACCCAACAGTCAACGCTACCTACCTCCAAACCCTTCAGCAGCTCTGC
CCTCAGAACGGATCCGTTGCCGTTTTGGCCAACCTGGACCGCTCCACCGCCGACGGATTCGACTCCACATACTTTACCAATCTCCAGACCCAGGAGGGGCTCCTTGAGAGCGACCAGGCA
CTGTTCTCCACTCCGAATTCCGACACCATCGCACTCGTGAACACCTTTAGCGCCAACCAGACGGCCTTCTTCGAGAGCTTTGTTAACTCCATGATTAGGATGGGCAACATTCCTCCCCCC
GCTGGGAGTGCCGGTGAGATTAGGCTCAATTGCAGGGTTATTAACCCTGCTGCTTCTGGTACTGCTGTGATTACAACTCCGGCTGGTTTTGTTGATGTGGACGGTGGTGAGGAGATGAAC
CGATTTGCTAGTGATATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGTCTTGTCTTTGGTTGCCACATTGTTGATGCTGTTGAGCATTGGAGTGAGCAATGCACAGCTGACACCAACGTTCTACAACACGACGTGCCCCGAAGTGACCAACATCGTCCGT
CAAGTTCTTCAGAATTTCGCATTCACCGACCCTAGAATCGGGGCCAGCCTTATCAGGCTTCACTTCCACGATTGCTTTGTTACGGGGTGCGACGCATCGGTCCTGCTGGACAACAATGCG
AATGCGATGATCGAGAGCGAGAAGCAAGCGGCTCCGAATAACGGATCCTTGAGAGGGTTCGAAGTCGTTGATGCGATGAAGAGCCAGATCGAAGCTGTTTGCCCCGGAGTTGTTTCTTGT
GCCGATATTCTCAGCATTGCTTCTGAAGAATCTGTTGTCTTG
GCTGGAGGGCCATCATGGGCAGTTCCGTTGGGAAGGCTGGATAGCGTAGCTGCAAACAGGACATTAGCAAATTCAGCA
CTTCCACCTCCGTTTTTCACCGTCGATCAGCTGAAAGCTATGTTCGCCGCCGTAGGCCTCAACACCACCGTAGACCTCGTTGCTCTCTCGG
GAGCGCACACTTTCGGAAGGGCCCAATGC
GGAAACTTCGTAAACAGGCTTTACAACTTCAACGGCACAGGAAGCCCAGACCCAACAGTCAACGCTACCTACCTCCAAACCCTTCAGCAGCTCTGCCCTCAGAACGGATCCGTTGCCGTT
TTGGCCAACCTGGACCGCTCCACCGCCGACGGATTCGACTCCACATACTTTACCAATCTCCAGACCCAGGAGGGGCTCCTTGAGAGCGACCAGGCACTGTTCTCCACTCCGAATTCCGAC
ACCATCGCACTCGTGAACACCTTTAGCGCCAACCAGACGGCCTTCTTCGAGAGCTTTGTTAACTCCATGATTAGGATGGGCAACATTCCTCCCCCCGCTGGGAGTGCCGGTGAGATTAGG
CTCAATTGCAGGGTTATTAACCCTGCTGCTTCTGGTACTGCTGTGATTACAACTCCGGCTGGTTTTGTTGATGTGGACGGTGGTGAGGAGATGAACCGATTTGCTAGTGATATTTGA

Retrieve as FASTA