Entry information : LuPrx45(Lus10008174|PACid:23173785)
Entry ID 12161
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx45(Lus10008174|PACid:23173785)
Name LuPrx45(Lus10008174|PACid:23173785)
Class Class III peroxidase    [Orthogroup: Prx166]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx45
start..stop
S start..stop
LuPrx148 664 0 1..357 6..362
LuPrx149 514 0 4..355 5..353
LuPrx01 502 5.93e-180 4..355 8..358
LuPrx151 498 2.86e-178 6..355 9..359
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '12161' 'complement(join(139452..139939,140021..140192,140252..140443,140959..141177))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140959..141177 217 N° 2 140252..140443 190 N° 3 140021..140192 170 N° 4 139452..139939 486
complement(join(139452..139939,140021..140192,140252..140443,140959..141177))


exon

Literature and cross-references LuPrx45(Lus10008174|PACid:23173785)
DNA ref. Phytozome 12:   scaffold480 (141177..139452)
Protein sequence: LuPrx45(Lus10008174|PACid:23173785)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356 (331)
PWM (Da):   %s   38089.03 (35324.5)  
PI (pH):   %s   4.8 (4.62) Peptide Signal:   %s   cut: 26 range:26-356
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPAKFLVSSLMALLMLVSAGRRSYALELTPTYYDSTCPAVTNIVRRVIENAAVADPRICASLIRLHFHDCFVSGCDASLLLDNSPTILSEKEAAGNNNSCRGYEVIDQMKTQVEDACPGV
VSCADILAIAAEEAVVLAGGPSWAVPLGRLDSLTANERSLVTSSLPHTNYTVDELKANFAAVGLNTTVDLVALSGAHTFGRVQCKGFKLRLYNFNNTGGPDPTLNATLLRSLRQLCPQDR
NDIVFTDLDKTTPDAFDSAYFRNLQRGEGIIWSDQVLFSAPGSDTVDIVNRFAANETTFFESFVDSMIRMGNIAPPAGSPGEIRRNCRVVNSASLAGKISATPAGSVNTDGFASDA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGCTAAGTTTCTAGTTTCTTCTTTGATGGCATTATTAATGCTGGTTTCTGCTGGTCGTCGGAGCTATGCACTGGAGCTTACTCCGACGTACTACGACTCGACTTGTCCCGCTGTT
ACAAACATCGTCCGTCGGGTCATCGAAAATGCTGCCGTGGCTGATCCCAGGATTTGTGCCAGCCTCATTAGGCTTCACTTCCACGATTGCTTCGTTAGT
GTAAGTACCGTGTGATTGTGT
CATTATTCTGTCCCAATAAATTAAGTAGATTTTTAAATAGCTTAATTACCCATTAAACTTGCCAAAATGTCATATGCTTGATCCTATTTCCAAACGAACATTATTTCTCCTGTGACGTCA
TTTACTTGAGCTCGTATACTCAAATCGTATATACGTATTTTGGTCGTACAATAATAGATACATGCATTATACGTAGGTCTCTCCTCCTCCGTGAATTCTTGTAGTGTCTTTCCTCCTCCT
CCTCCTCCTCCGTGAGAAGATAACTAGCTAGATGCATGACGCCACTTGCATTTTTTGTGGTTTCATCCCAACCGTCGGACCCCTCACGACCCACGACCATTCTAGGATGGGCGCCAGGAG
GTACTGACGAATTGTGATTCACATTACACTGTAAAAAATTATAGATGAATTGTGATTGAGCGGTTGAGTCCGAATTATATATATTAGAATTGTTGTGTCCCGTTTTGATGAGCGATCACG
GTGTTGACATGCAGGGGGATGTGATGCATCACTGTTGTTGGACAACAGTCCGACGATATTAAGCGAGAAAGAAGCGGCTGGTAATAACAACTCTTGTAGAGGGTATGAAGTCATTGATCA
AATGAAGACCCAAGTCGAGGATGCTTGTCCAGGGGTCGTTTCATGCGCCGACATTCTCGCCATCGCCGCCGAAGAAGCTGTTGTTTTG
GTAAGTATGTATTTTGAAGTTGTGATACGACG
CCGTACTGACATGGATATGAATTGTAGGCGCAGGAGGGCCATCATGGGCGGTCCCACTCGGAAGGCTAGACAGCTTGACGGCGAACGAAAGGAGTCTAGTAACTTCATCACTTCCTCATA
CGAATTACACCGTCGATGAGCTCAAAGCTAATTTCGCCGCCGTCGGCCTCAACACCACCGTCGACCTCGTTGCACTCTCAG
GTTATCATAACAAATATTAAATGATTAATAATCTCTGTC
GATCTCCTTAAATAAAAGGTAATTAATTGTTGTGGGTCGTAGGTGTGCTCACACGTTCGGGAGGGTCCAGTGCAAAGGATTCAAGCTGCGACTCTACAACTTCAACAACACGGGAGGCCC
AGACCCAACACTGAACGCCACGTTGCTCCGCTCGCTCCGCCAGCTGTGCCCTCAGGACCGCAACGACATCGTTTTCACGGACCTCGACAAAACAACCCCCGACGCATTTGACTCGGCCTA
CTTCAGAAACCTTCAGAGAGGAGAAGGAATCATCTGGAGCGACCAGGTCCTCTTCTCCGCTCCGGGTTCCGACACTGTTGACATTGTCAACCGGTTCGCAGCCAACGAGACGACCTTCTT
TGAGAGCTTTGTCGATTCGATGATTAGGATGGGGAACATTGCGCCTCCGGCGGGGAGTCCGGGTGAGATTCGGCGGAATTGCAGAGTTGTTAACTCCGCCTCCTTAGCCGGTAAGATTAG
TGCTACTCCGGCTGGTTCTGTTAATACGGATGGTTTTGCGAGTGACGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGCTAAGTTTCTAGTTTCTTCTTTGATGGCATTATTAATGCTGGTTTCTGCTGGTCGTCGGAGCTATGCACTGGAGCTTACTCCGACGTACTACGACTCGACTTGTCCCGCTGTT
ACAAACATCGTCCGTCGGGTCATCGAAAATGCTGCCGTGGCTGATCCCAGGATTTGTGCCAGCCTCATTAGGCTTCACTTCCACGATTGCTTCGTTAGT
GGATGTGATGCATCACTGTTG
TTGGACAACAGTCCGACGATATTAAGCGAGAAAGAAGCGGCTGGTAATAACAACTCTTGTAGAGGGTATGAAGTCATTGATCAAATGAAGACCCAAGTCGAGGATGCTTGTCCAGGGGTC
GTTTCATGCGCCGACATTCTCGCCATCGCCGCCGAAGAAGCTGTTGTTTTG
GCAGGAGGGCCATCATGGGCGGTCCCACTCGGAAGGCTAGACAGCTTGACGGCGAACGAAAGGAGTCTA
GTAACTTCATCACTTCCTCATACGAATTACACCGTCGATGAGCTCAAAGCTAATTTCGCCGCCGTCGGCCTCAACACCACCGTCGACCTCGTTGCACTCTCAG
GTGCTCACACGTTCGGG
AGGGTCCAGTGCAAAGGATTCAAGCTGCGACTCTACAACTTCAACAACACGGGAGGCCCAGACCCAACACTGAACGCCACGTTGCTCCGCTCGCTCCGCCAGCTGTGCCCTCAGGACCGC
AACGACATCGTTTTCACGGACCTCGACAAAACAACCCCCGACGCATTTGACTCGGCCTACTTCAGAAACCTTCAGAGAGGAGAAGGAATCATCTGGAGCGACCAGGTCCTCTTCTCCGCT
CCGGGTTCCGACACTGTTGACATTGTCAACCGGTTCGCAGCCAACGAGACGACCTTCTTTGAGAGCTTTGTCGATTCGATGATTAGGATGGGGAACATTGCGCCTCCGGCGGGGAGTCCG
GGTGAGATTCGGCGGAATTGCAGAGTTGTTAACTCCGCCTCCTTAGCCGGTAAGATTAGTGCTACTCCGGCTGGTTCTGTTAATACGGATGGTTTTGCGAGTGACGCTTGA

Retrieve as FASTA